📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 About the Job Experience: 7 -9 years Work Location: Bangalore/Hyderabad Designation: Module lead (Microsoft Fabric Data engineer) Role Description: We are looking for a Senior Data Engineer with strong Microsoft ...
📑 1. Position Summary The Data Engineering Lead is responsible for designing, building and operating data platforms and pipelines required for AI, analytics and automation use cases. The role leads a team of Data Engineers to implement the data architecture defined by the Architecture Lead and Solution A ...
📑 How You’ll Contribute As a Consultant Product Security, you will guide the organization in designing and implementing secure software development practices by collaborating with development, DevOps, and operations teams to embed security throughout every phase of the software develop ...
📑 About Us Trevolution is a global leader in air ticketing and travel services, serving retail and corporate clients across 50+ markets. With over 20 years of expertise and a strong entrepreneurial mindset, we combine modern technology with a customer-first approach to simplify travel. Thr ...
📑 About Us Trevolution is a global leader in air ticketing and travel services, serving retail and corporate clients across 50+ markets. With over 20 years of expertise and a strong entrepreneurial mindset, we combine modern technology with a customer-first approach to simplify travel. Thr ...
📑 Job Title: Lead Engineer – Security Operations Department: Engineering and Operations Location: Mumbai Reporting: Manager Security Operations Job Type: Full Time Shift: Rotational Shift PRE-REQUISITES ...
📑 Location: India (Remote / Hybrid) Experience: ~14+ Years in Computational Engineering, Aero-thermal Sciences, and Scientific Machine Learning (SciML) Domain: Renewable Energy, Wind Turbine Aerodynamics, Aerospace Simulations The Mission Tr ...
📑 Location: Noida / Chennai / Bangalore / Pune Experience: 10+ years Position Overview We are looking for a dynamic and client-focused Data & AI Presales Solution Architect who brings deep presales expertise combined with strong solution design and deliver ...
📑 Location: Noida / Chennai / Bangalore / Pune Experience: 10+ years Position Overview We are looking for a dynamic and client-focused Data & AI Presales Solution Architect who brings deep presales expertise combined with strong solution design and deliver ...
📑 About Seller Rocket:Seller Rocket is a bootstrapped marketplace growth agency headquartered in Bangalore, with offices in Thanjavur and Ahmedabad. We manage 200+ brand accounts across leading marketplaces including Amazon, Flipkart, Myntra, Meesho, Ajio, Etsy, and Amazon Global. Our 150+ member team delivers ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimiz ...
📑 Job title: Senior Data Engineer (Airflow Specialist) Company: Hvantage Tech Solutions Pvt. Ltd. Department: Enterprise Applications / Healthcare IT Location: Remote / Hybrid / Onsite (as applicable) Employment Type: Full-Time Experi ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Please Note :1. If you are a first time user, please create your candidate login account before you apply for a job. (Click Sign In > Create Account)2. If you already have a Candidate Account, please Sign-In before you apply.Job Description:</p ...
📑 Job title: Senior Data Engineer (Airflow Specialist) Company: Hvantage Tech Solutions Pvt. Ltd. Department: Enterprise Applications / Healthcare IT Location: Remote / Hybrid / Onsite (as applicable) Employment Type: Full-Time Experi ...
📑 Job title: Senior Data Engineer (Airflow Specialist)Company: Hvantage Tech Solutions Pvt. Ltd.Department: Enterprise Applications / Healthcare ITLocation: Remote / Hybrid / Onsite (as applicable)Employment ...
📑 Job title: Senior Data Engineer (Airflow Specialist) Company: Hvantage Tech Solutions Pvt. Ltd. Department: Enterprise Applications / Healthcare IT Location: Remote / Hybrid / Onsite (as applicable) Emp ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 Role: Embedded Software Engineer Industry Type: Space TechnologyLocation: BangaloreEmployment Type: Full-time</p ...
📑 Data Engineering Senior ManagerPosition OverviewAre you looking for an opportunity to lead an engineering team to engineer modern solutions across a breadth of platforms and technologies supporting a business that’s core to Cigna’s and Evernorth’s strategy?We’re looking for a leader ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 Job title: Senior Data Engineer (Airflow Specialist) Company: Hvantage Tech Solutions Pvt. Ltd. Department: Enterprise Applications / Healthcare IT Location: Remote / Hybrid / Onsite (as applicable) Employment Type: Full-Time Experi ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 Job title: Senior Data Engineer (Airflow Specialist) Company: Hvantage Tech Solutions Pvt. Ltd. Department: Enterprise Applications / Healthcare IT Location: Remote / Hybrid / Onsite (as applicable) Emp ...
📑 Position SummaryThe Citi Analytics & Information Management (AIM) team is a global community that objectively connects and analyzes information to create actionable intelligence for our business leaders. This role is a part of the AIM Fraud Prevention Analytics team, reporting to Director ...
📑 Company Description Our Client in India is one of the leading providers of risk, financial services and business advisory, internal audit, corporate governance, and tax and regulatory services. Our Client was established in India in September 1993, and has rapidly built a signifi ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 Security Lead (GRC & AppSec) Location: Hyderabad, India Employment Type: Full-Time; Salaried Compensation: Base Salary, Bonus, Stock Options, Medical About Innovapptive Innovapptive is an enterprise SaaS company building an AI-powered Connected Worker Platform for industrial organizations. Our platfo ...
📑 Job title: Senior Data Engineer (Airflow Specialist)Company: Hvantage Tech Solutions Pvt. Ltd.Department: Enterprise Applications / Healthcare ITLocation: Remote / Hybrid / Onsite (as applicable)Employment Type: Full-TimeExperience Requi ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About HuzzleAt Huzzle, we connect exceptional talent with top opportunities at leading companies across the UK, US, Canada, Europe, and Australia. Our clients include fast-growing startups, digital agencies, SaaS companies, and tech-enabled businesses across industries such as MarTech, FinTech, EdTec ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 &xa;&xa;Working at Infobip means being part of something truly global. With + offices across six continents, we’re not just building technology — we’re shaping how more than % of the world connects and communicates.As employees, we take pride in contributing to the world’s largest and only full-stack c ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,069,334+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
| Backend Developer | Education Dynamics, Inc. | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!