📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **About this role:** Wells Fargo is seeking a... **In this role, you will:** + Lead moderately complex initiatives and deliverables within technical domain environments+ Contribute to large scale planning of strategies+ Design, code, test, debug, and document for projects and p ...
📑 **About this Role:** Wells Fargo is seeking a **Lead Software Engineer.** **In this role, you will:** + Lead complex technology initiatives including those that are companywide with broad impact+ Act as a key participant in developing standards and companywide best practices for e ...
📑 **About this role:** Wells Fargo is seeking a Senior Software Engineer. **In this role, you will:** + Lead moderately complex initiatives and deliverables within technical domain environments+ Contribute to large scale planning of strategies+ Design, code, test, debug, and docu ...
📑 **About this role:** Wells Fargo is seeking a... **In this role, you will:** + Lead moderately complex initiatives and deliverables within technical domain environments+ Contribute to large scale planning of strategies+ Design, code, test, debug, and document for projects and p ...
📑 We are looking for a Full Stack Software Engineer with strong **UI engineering, web development** , and **Azure cloud experience** to build scalable, high quality digital applications. The ideal candidate will have hands-on proficiency in React/Vue, **API development, cloud-native patterns, and Azure service ...
📑 We are looking for a Full Stack Software Engineer with strong **UI engineering, web development** , and **Azure cloud experience** to build scalable, high quality digital applications. The ideal candidate will have hands-on proficiency in React/Vue, **API development, cloud-native patterns, and Azure service ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 Job Description It’s not just about your career or job title… It’s about who you are and the impact you will make on the world. Because whether it’s for each other or our customers, we put People First. When our people come together, we Expand the Possible and continuously look for ways to improve what ...
📑 **Job Description** At Boeing, we innovate and collaborate to make the world a better place. We’re committed to fostering an environment for every teammate that’s welcoming, respectful and inclusive, with great opportunity for professional growth. Find your future with us. **Overview** <br ...
📑 **Our Company** At Teradata, we believe that people thrive when empowered with better information. Teradata Autonomous Knowledge Platform activates enterprise intelligence by unifying data, knowledge and business context to achieve tangible outcomes. With Teradata, organizations can provide agents with ...
📑 **Requisition number:** 2356374**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...
📑 **ABOUT AMGEN** **Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology indust ...
📑 **ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, making people’s lives easier, fuller, and longer. We discover, develop, manufacture, and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
📑 **ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
📑 **ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
📑 **ABOUT THE ROLE** Let’s do this. Let’s change the world. We are looking for a motivated Software Development Engineer II to join our Manufacturing Applications Product Team. This is a junior/mid-level role focused on building and enhancing full stack applications that support Manufacturing and Operatio ...
📑 **ABOUT THE ROLE** Role Description: The **Senior Full Stack Engineer** will design, build, and deliver modern web applications that power Amgen’s next-generation digital platforms. This hands-on engineering role requires deep experience in modern UI frameworks ( **React, TypeScript, JavaScript** ) co ...
📑 Fullstack Software Engineer **What you will do** Let’s do this. Let’s change the world. In this vital role you we are seeking a dedicated and motivated Full Stack Software Engineer to join our Global Commercial Digital Innovation team + Develop and maintain front-end applications using ...
📑 **ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
📑 **Job Requisition ID #** 26WD97001 **Position Overview** As a global leader in 3D design, engineering, and entertainment software, Autodesk helps people imagine, design and create a better world. Autodesk accelerates better design through an unparalleled depth of experience and a broad ...
📑 **Job Requisition ID #** 26WD96635 **Position Overview******Are you energised by shaping technical direction and building platform-scale systems that power experiences for millions of users? Autodesk’s Growth Experience Technology (GET) — APAC Engineering is hiring a Senior Principal E ...
📑 **Job Requisition ID #** 26WD98900 **Position Overview** Autodesk Identity Access and Management team is seeking a talented and highly motivated individual who loves to find and develop efficient, scalable, and thoughtful solutions to various technical and product challenges. ...
📑 **Description** + Develop and maintain backend services using Python (Fast API/Django/Flask) + Build responsive UI using React or Svelte + Design and consume REST/GraphQL APIs + Work with cloud platforms like GCP and/or Azure + Collaborate on AI-driven features ...
📑 The Applications Development Technology Lead Analyst is a senior level position responsible for establishing and implementing new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to lead applications systems analysis and programming activ ...
📑 **Role Overview** We are seeking a highly skilled and experienced Full Stack Developer (Full Time) to contribute to our development efforts, focusing on building robust and scalable applications. The ideal candidate will possess deep expertise in both front-end and back-end technologies, with a strong e ...
📑 **44360BR****Requisition ID:** 44360BR **Business Unit:** COR **Job Description:** Role Overview:CDM Smith is seeking a Senior Applications Developer to join our Digital Capital team, focusing on Generative AI and Copilot-driven solutions.You will lead the ...
📑 We are seeking a highly skilled and experienced Senior Full stack Developer to join our Engineering Excellence team. This team acts as a force multiplier for our entire engineering organization, championing innovation, promoting best practices, and building the tools and frameworks that enable our developers to ...
📑 The Production Engineer is a pivotal role within Citi's Technology organisation, responsible for designing, building, and operating the intelligent systems that underpin our global production environment. This is an engineering-first position at the intersection of software craftsmanship, AI-native development, ...
📑 **Overview:** Finance Technology, enables Citi to achieve its day-to-day and long-term growth goals, enabling execution of Citi’s Strategy by providing services, technical solutions, and infrastructure across the bank. These solutions enable Citi to comply with regulatory mandates and empower our busine ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to applic ...
📑 We are seeking a highly skilled and motivated Fullstack Developer with expertise in Java for backend development and Angular for frontend development. The ideal candidate will be responsible for designing, developing, and maintaining robust and scalable enterprise-level applications. This role requires a strong ...
📑 **The Role** We are looking for experienced full-stack software engineers who are passionate about solving business problems through innovation and engineering practices. This role will be responsible for writing code, pairing with other developers as appropriate, decomposing acceptance criteria to unde ...
📑 The Applications Development Technology Lead Analyst is a senior level position responsible for establishing and implementing new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to lead applications systems analysis and programming activ ...
📑 **44360BR****Requisition ID:**44360BR**Business Unit:**COR**Job Description:**Role Overview:CDM Smith is seeking a Senior Applications Developer to join our Digital Capital team, focusing on Generative AI and Copilot-driven solutions.You will lead the design, development, and scal ...
📑 **Meet the Team** The Cisco Wireless Feature & System Engineering team builds end-to-end wireless capabilities across access points, controllers, and cloud-managed platforms. We design features that span device software, control planes, and management systems to deliver seamless, secure, and high-perfor ...
📑 Job DescriptionJob DescriptionThe Applications Development Senior Lead is a senior developer level position responsible for accomplishing results through the management of a team or department in an effort to establish and implement new or revised application systems and programs in coordination with the ...
📑 **_Excited to grow your career?_** We value our talented employees, and whenever possible strive to help one of our associates grow professionally before recruiting new talent to our open positions. If you think the open position you see is right for you, we encourage you to apply! Our people m ...
📑 The Applications Development Group Manager is a senior management level position responsible for accomplishing results through the management of a team or department in an effort to establish and implement new or revised application systems and programs in coordination with the Technology Team. The overall objec ...
📑 The Production Engineer is a pivotal role within Citi's Technology organisation, responsible for designing, building, and operating the intelligent systems that underpin our global production environment. This is an engineering-first position at the intersection of software craftsmanship, AI-native development, ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to applic ...
📑 **44360BR****Requisition ID:**44360BR**Business Unit:**COR**Job Description:**Role Overview:CDM Smith is seeking a Senior Applications Developer to join our Digital Capital team, focusing on Generative AI and Copilot-driven solutions.You will lead the design, development, and scal ...
📑 Job Posting Description**Java Full Stack Developer**Philips is a global leader in health technology, dedicated to improving lives through meaningful innovation. One of our five core businesses, **Connected Care** , focuses on delivering smarter, data-driven solutions that connect patients, providers, and ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,541,027+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Lead Application Developer - .Net Full Stack | UPS | Full-time |
| Senior Application Developer - .Net... | UPS | Full-time |
| Senior Software Engineer -Java Full stack | Wells Fargo | Full-time |
| Lead Software Engineer - Full Stack Engineer | Wells Fargo | Full-time |
| Senior Software Engineer - Java Full stack | Wells Fargo | Full-time |
| Senior Software Engineer -Java Full stack | Wells Fargo | Full-time |
| Software Development - Full Stack with UI | WSP USA | Full-time |
| Software Development - Full Stack with UI | WSP USA | Full-time |
| Lead Application Developer - .Net Full Stack | UPS | Full-time |
| Intermediate Application Developer -... | UPS | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!