909,697+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

AVP Co Brand & Enterprise Lifecycle Marketing Analytics (L11)

📑 **Role Title: AVP Co-Brand & Enterprise Lifecycle Marketing Analytics (L11)** **Company Overview:** Synchrony (NYSE: SYF) is a premier consumer financial services company delivering one of the industry’s most complete digitally enabled product suites. Our experience, expertise and scale encompa ...

Solutions Architect, Conglomerates, AGS APJ India SA Conglomerates

📑 DescriptionAWS Global Sales (AGS) is responsible for driving revenue, adoption, and growth from the largest and fastest growing small- and mid-market accounts to enterprise-level customers including public sector. Are you excited to work with the team that enables India’s conglomerates to build inno ...

Solutions Architect, Conglomerates, AGS APJ India, Conglomerates SA Team

📑 DescriptionThis role is open to candidates based in Mumbai and Pune. AWS Global Sales (AGS) is responsible for driving revenue, adoption, and growth from the largest and fastest growing small- and mid-market accounts to enterprise-level customers including public sector. Are you excited to ...

Senior Power Platform Application Developer

📑 Senior Power Platform Application Developer **About Advanced Energy** Advanced Energy Industries, Inc. (NASDAQ: AEIS), enables design breakthroughs and drives growth for leading semiconductor and industrial customers. Our precision power and control technologies, along with our applications kno ...

Solutions Architect, Conglomerates, AGS APJ India SA Conglomerates

📑 DescriptionAWS Global Sales (AGS) is responsible for driving revenue, adoption, and growth from the largest and fastest growing small- and mid-market accounts to enterprise-level customers including public sector. Are you excited to work with the team that enables India’s conglomerates to build inno ...

Staff Software Engineer, Google Cloud

📑 Staff Software Engineer, Google Cloud _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Hyderabad, Telangana, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_ ...

Senior Software Engineer, Precision Medicine

📑 **Work Hours:** This position requires you to work a later shift and may be assigned a second shift schedule. Candidates must be willing and able to work during evening or night shifts, as required. Potential Shifts (subject to change based on business requirements): Second Shift: 2:00pm – 10:00pm IST< ...

Software Engineer III

📑 Software Engineer III Bengaluru, KA, India(Hybrid) **Job Description** The Enterprise Technology Services organization partners with every part of the American Express business to power the company’s growth and innovation with trust and efficiency, and drive competitive differentiation ...

Senior Software Engineer, Precision Medicine

📑 Work Hours: This position requires you to work a later shift and may be assigned a second shift schedule. Candidates must be willing and able to work during evening or night shifts, as required. Potential Shifts (subject to change based on business requirements): Second Shift: 2:00pm – 10:00pm IST ...

Director Growth Partnership Lead

📑 Role Overview:Tredence is looking for a Director – Growth Partnership Lead to drive focused channel growth and strategic alliances, with a strong emphasis on hyperscaler ecosystems (Microsoft, AWS) and emerging data/AI partners.This role will own end-to-end partnership strategy, GTM, and revenue accelera ...

Lead data engineer

📑 Job Title: Lead Data Analytics Engineer Location: Bangalore Experience: 8–12+ years I. Job Summary: The Lead Data Analytics Engineer will be responsible for defining, building, and evolving the analytics data layer across Papa John's end-to-end analytics stack. This role partners cl ...

AI Infrastructure Partnership Manager

📑 Startup & ISV ManagerLocation - Delhi NCR/BengaluruIndia's AI economy is being built right now — and the startups and ISVs at the centre of it need infrastructure that scales with their ambition. At Yotta, we are looking for someone who can own the GTM ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Data Engineer

📑 At VIDA we’re building the future of digital identity. As a Data Engineer you’ll work across the stack—from platform and infrastructure to data pipelines and end-user tooling. You’ll help us modernize our batch ETLs and lead our push into streaming and real-time fraud detection . We run on AWS and make extens ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Startup & ISV Manager

📑 Startup & ISV Manager Location - Delhi NCR/Bengaluru India's AI economy is being built right now — and the startups and ISVs at the centre of it need infrastructure that scales with their ambition. At Yotta, we are looking for someone who can own the GTM motion for ...

Startup & ISV Manager

📑 Startup & ISV ManagerLocation - Delhi NCR/BengaluruIndia's AI economy is being built right now — and the startups and ISVs at the centre of it need infrastructure that scales with their ambition. At Yotta, we are looking for someone who can own the G ...

Project Manager – Dynamics 365

📑 Role Title:Project Manager – Dynamics 365 CRMExperience:3–6 YearsLocation:[In Office]Department:Microsoft Business Applications PracticeRole OverviewWe are seeking a young and dynamic ProjectManagerto lead end-to-end delivery across ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Senior Data Engineer

📑 Experience Required: 5 to 7 yearsYour Key Responsibilities: Develop long-term vision for a highly scalable data platform, data management and Data Ops practices.Design and architect data flows, data management in Hadoop or Cloud environment which are sca ...

Big Data Engineer

📑 Role - Data EngineerExperience - 3-5 yrsLocation - BangaloreWe are looking for a Data Engineer II (SDE-2) to join our data team. The ideal candidate will be a play a key role to develop of high performant and ...

Data Engineer

📑 Role - Data Engineer Experience - 3-5 yrs Location - Bangalore We are looking for a Data Engineer II (SDE-2) to join our data team. The ideal candidate will be a play a key role to develop of high performant and scalable Data Lake-house , ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Solutions Consultant

📑 Manager - Solutions Consultant (Enterprise Deals)Bengaluru | Mumbai | Bengaluru5-10 Years Exp | $50K-$100K ARR DealsIgnite Enterprise Growth with Netcore !Are you a presales powerhouse who turns complex enterprise challenges into multi-million ARR wins?AtNetcore, we' ...

Digital Product Manager

📑 Key Responsibilities1. Technical Strategy & Platform ArchitectureUnified Roadmap: Define and drive the future state of the unified platform, aligning on-premises legacy systems with scalable cloud innovation in Azure and AWS.Lifecycle Management: O ...

Data Engineer

📑 Role - Data Engineer Experience - 3-5 yrs Location - Bangalore We are looking for a Data Engineer II (SDE-2) to join our data team. The ideal candidate will be a play a key role to develop of high performan ...

Systems Developer(.NET & AI/ML)

📑 This job is with Thermo Fisher Scientific, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Work ScheduleSecond Shift (Afternoons)Environmental ConditionsOfficeJob Descriptio ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Engineer I, Project Tez | AmazonNow (Quick Commerce, 10 min delivery)

📑 This job is with Amazon, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.DESCRIPTION:Come, be part of Amazon's foray into Quick Commerce with the Amazon Now (Tez) QA team.We are bui ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Data Engineer

📑 Role - Data Engineer Experience - 3-5 yrs Location - Bangalore We are looking for a Data Engineer II (SDE-2) to join our data team. The ideal candidate will be a play a key role to develop of high performant and scalable Data Lake-house , ...

Startup Ecosystem Lead

📑 Startup & ISV ManagerLocation - Delhi NCR/BengaluruIndia's AI economy is being built right now — and the startups and ISVs at the centre of it need infrastructure that scales with their ambition. At Yotta, we are looking for someone who can own the GTM ...

Startup & ISV Manager

📑 Startup & ISV Manager Location - Delhi NCR/Bengaluru India's AI economy is being built right now — and the startups and ISVs at the centre of it need infrastructure that scales with their ambition. At Yotta, we are looking for someone who can own the GTM motion for ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Manager accounting, reporting and consulting(arc)

📑 About UniqusUniqus is a tech-enabled global consulting company that specializes in Accounting & Reporting Consulting (ARC), Governance, Risk & Compliance (GRC), Sustainability & Climate Consulting (SCC), Tech Consulting and Valuations, by leveraging high-performing global talent. Our consulting solutions are ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Cloud Solutions GTM Specialist

📑 Startup & ISV ManagerLocation - Delhi NCR/BengaluruIndia's AI economy is being built right now — and the startups and ISVs at the centre of it need infrastructure that scales with their ambition. At Yotta, we are looking for someone who can own the GTM ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...

Quality Assurance Automation Engineer

📑 Help with and implement our QA Architectural Artifacts• All testing systems, their feedback loops and mechanisms, logging, reporting and interconnectivity• Process artifacts that detail how, where and why quality controls and test mechanisms exist across the entire SDLC• Implementation level architec ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 909,697+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
AVP Co-Brand & Enterprise Lifecycle... Synchrony Full-time
Solutions Architect, Conglomerates,... Amazon Full-time
Solutions Architect, Conglomerates,... Amazon Full-time
Senior Power Platform Application Developer Advanced Energy Full-time
Solutions Architect, Conglomerates,... Amazon Full-time
Staff Software Engineer, Google Cloud Google Full-time
Senior Software Engineer, Precision Medicine Amgen Full-time
Software Engineer III American Express Full-time
Senior Software Engineer, Precision Medicine Amgen Full-time
Director - Growth Partnership Lead Tredence Inc. Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!