📑 Job Role - HR Recruiter Qualification - Minimum GraduateExperiences - Minimum six Month in recruitment.Job Location - Mumbai , Nashik , Aurangabad, Bhiwandi, Pune.Skill Required - Sourcing , Screening , Bulk Hiring . Experience 1 - 3 Years No. of Openings 10 < ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 Cardiac Anesthetist :UP - Agra, LucknowGujarat - Ahmedabad, Bhavnagar For More details or to apply:- Contact:Hargun Kaur, HR Associate (.E)+Experience0 - 6 YearsNo. of Openings3EducationMBBS, MD/Medicine Doctor, Ph.D/DoctorateRole ...
📑 Seeking a skilled Firmware Engineer in Nerul, Navi Mumbai, with 3-5 years of experience and a Diploma in relevant field. Responsibilities include developing embedded systems, implementing communication protocols like UART, SPI, and I2C, and ensuring smooth operation of firmware. Key skills required include exper ...
📑 Job Summary:We are seeking a detail-oriented and results-driven Project Manager to lead and manage projects from initiation through delivery. The ideal candidate will coordinate internal resources, third parties, and vendors to ensure all aspects of the project are delivered on-time, within ...
📑 Job Openings for 10 manual accountant Jobs with minimum 2 Years Experience in Surat, having Educational qualification of : Higher Secondary, Secondary School, , , with Good knowledge in Manual Accounting etc. Experience 2 - 3 Years No. of Openings 10 ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / ...
📑 Responsibilities:Test Planning and Design: Participate in the review of requirements and technical specifications to understand the system under test. Design and develop comprehensive test plans and test cases based on technical understanding.Test Case Development: Create detailed, well-structured test cases and ...
📑 - GOOD KNOWLEDGE OF COMPUTER, EXCEL, WORD, ETC.- GOOD COMMUNICATION SKILLS, SPEAK GOOD ENGLISH- CUSTOMER CONVINCING SKILLS, PROBLEM SOLVING SKILLS. Experience 0 - 1 Years No. of Openings 1 Education Higher Secondary, Secondary School, Diploma, ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Key Responsibilities:Collect and test influent and treated water samples.Analyze parameters like pH, TDS, TSS, COD, BOD, Oil & Grease, etc.Prepare and maintain chemical solutions for treatment.Adjust chemical dosing as per test results.Maintain laboratory equipment and calibration records.Maintain daily analysis ...
📑 Government proposed jobVery high chance to get permanent govt job in LIC as this is financial Advisor professional scheme launch by our honorable PM mr Modi ji so hurry up call me Experience0 - 5 YearsNo. of Openings120EducationHigher Secondary ...
📑 manages an organization's financial health by recording transactions, preparing financial statements (P&L, Balance Sheet, Cash Flow), managing budgets, ensuring tax compliance, and analyzing data to advise leadership on financial strategy, cost reduction, and profit enhancement, working with various departments ...
📑 Post - 1Jewelry Sales - FemaleB2B and B2CSmart and good-lookingJob Location- = SaroliJob Time - to Experience - 2 to 3 years in same fieldGraduate in any field Computer knowledge Fluent in English Customer service and follow-up Salary - as per experience Experience 2 - 3 Years ...
📑 Position: Senior Instructor &nb ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Stores executive required for a Food Trading company in Turbhe MIDCSkills inward outward entriesKeeping stock detailsexcel knowledge requiredEducation min 12thExperience min 2 years plus in StoresExperience2 - 8 YearsNo. of Openings1Education10th Pass</ ...
📑 taking orders from shopsExperienceFresherNo. of Openings2Education10th PassRoleSales ManIndustry TypeFMCG / Retail / Food / BeveragesGender[ Male / Female ]Job Country< ...
📑 Job Openings for 2 VMC Programmer Jobs with minimum 1 Year Experience in Kotambi, Vadodara, having Educational qualification of : Diploma with Good knowledge in VMC Machine, Siemens S7, VMC Programmer, Siemens PLC etc. Experience 1 - 2 Years No. of Openings 2 ...
📑 Who's Candidates, Intrested in kitchen work, And Want Carrier in hotel Industry, only those candidates applyExperience0 - 1 YearsNo. of Openings15EducationSecondary SchoolRoleKitchen HelperIndustry TypeHotel ...
📑 Position: Consultant General Laparoscopic Surgeon Qualification: MS/DNB (General Surgery)Experience: Any (all consider) Package: In Negotiable termsJob Description: - Perform operations involving the endocrine system, gastrointestinal tract, liver, colon, and other major parts of the human body. As a general sur ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 !. requires experience in commercial building design2. design in auto cad 3dlocation : ghansolicontract based job name : pooja gurjaremail id :number :Experience3 - 4 YearsNo. of Openings1EducationI.T.I.RoleCivil Draftsman</li ...
📑 Responsibilities:Project Planning and Design: Participate in site investigations, surveys, and data collection. Develop preliminary and detailed designs for civil engineering projects, including roads, bridges, buildings, water supply systems, drainage systems, and other infrastructure.Structural Analysis and De ...
📑 Job DescriptionLocation: Mumbai/Bangalore/Chennai/Kochi/Kolkata/Ahmedabad/Pune/HyderabadAbout the vacancy:2nd Line of Defense 2LoDOur focus continues to be on audit quality underpinned by professional skepticism, independence and strong professional capabilities and this becomes more critical in times such as no ...
📑 Food Preparation:Assembling food items according to customer orders, ensuring consistency and quality.Cooking food in the oven, monitoring cooking times, and ensuring proper temperature.Customer Service:Taking customer orders online.Answering customer inquiries, making recommendations, and processing transaction ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 Dispatch Head Gender : Male Qualification : Diploma in Mechanical Engineering / BE in Mechanical Engineering Designation : Dispatch Head Experience : 4 5 Years Salary Range : 15K to 25K Technical Skills: Proficiency in logistics and dispatch management Strong knowledge of supply chain and logistics operations Ex ...
📑 Video Editor (Full Time) Bahadurgarh, Sonipat Share RSS Feed requirement for Video Editor The Candidate Should be proficient in the following Adobe premier pro Adobe after effect Adobe photoshop Adobe Illustrator Knowledge of coral draw will be plus point S ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 Tele-caling, voice processExperience0 - 3 YearsNo. of Openings25EducationHigher SecondaryRoleTelecallerIndustry TypeCall Centre / BPO / KPO / ITES / LPOGender[ Male / Female ] ...
📑 We are looking for an enthusiastic and result-driven Tele caller to promote and sell our insurance CRM software solutions. The ideal candidate will have prior experience in telesales or customer support, preferably in the finance or insurance domain.Make outbound calls to potential customers (cold/warm leads) to ...
📑 The role is of Business Specialist. The candidates have to make plannings and strategies to help make their business grow. They have to talk to clients and help business to grow and also their work is to promote, advertise and the work assigned to them. Experience 0 - 6 Years N ...
📑 To Arrange Cloth in Order, to Convince Customer, SalesExperience0 - 6 YearsNo. of Openings2Education12th PassRoleSalesmanIndustry TypeTextile / Garments / Fashion / AccessoriesGenderMa ...
📑 Team player,effective communication skills, basic understanding of organization culture and behavior Experience 0 - 6 Years No. of Openings 20 Education MBBS Role Medical Officer Industry Type ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Skills & Requirements:Sound knowledge in Python (FastAPI)AWSPostgreSQL / SupabaseQueuing systems (Kafka, Airflow)Knowledge in GEN-AI, ML, DL, TensorFlow, PyTorchKey Responsibilities: Write clean, scalable, and efficient codeDevelop back-end components to improve responsiveness and performanceIntegrate user-facin ...
📑 • JMS • Junit • Knowledge of IBM OS/MVS and IMS • SQL/DDL/DML in an AUP (Agile Unified Process) development environment • (Horizon tool chain: Bitbucket/Jenkins/Ant/Maven/Selenium/Ansible/etc). • JCL a plus ...
📑 Prance Salon Infopark, KakkanadPosition: Beautician / Hair StylistSalary: 12,000 30,000 (Based on skills & experience)Benefits:Free AccommodationMonthly 4 Days OffPerformance IncentivesProfessional & Friendly Work Environment--- ResponsibilitiesBeauty ServicesEyebrow threading & shapingWaxing (Full body, underar ...
📑 Urgent opening For Design Engineer- Nashik - DIPLOMA / BEMale / Female Freshers /Experienced.Sal - 15 K to 35 K Experience 0 - 3 Years No. of Openings 3 Education Diploma, B.E Role Design Engineer ...
📑 making/receiving calls to engage customers, generate leads, provide info, and resolve issues, focusing on sales, customer service, or market research, requiring strong communication, persuasion, and target achievement via tasks like outbound calls, handling inquiries, updating CRM, and documenting interactions<l ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / ...
📑 - Oversee the daily operations of the dispatch department: This includes managing schedules, coordinating with drivers, and ensuring timely delivery of goods to customers.- Monitor inventory levels and coordinate with suppliers: Keeping track of inventory levels to prevent stockouts and working closely with supp ...
📑 we are currently seeking a skilled and creative wedding video editor to join our picsgraphy office team. as a wedding video editor, you will be responsible for creating captivating and cinematic wedding videos that will be cherished by couples for a lifetime. your role will involve editing and post-production wo ...
📑 **PGT Physics Teacher Job Description** We are seeking a dedicated and experienced PGT Physics Teacher to join our institution in Lucknow. The ideal candidate will possess in-depth knowledge of Physics and the ability to teach students at the senior secondary level (Classes XI and XII). Responsibilities include ...
📑 We have vacant of 10 payment collection Jobs in Surat, Experience Required : 1 Year Educational Qualification : Higher Secondary, Secondary School Skill Payment Collection etc. Experience 1 - 2 Years No. of Openings 10 Education Higher Seconda ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,038,808+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| HR Recruiter (Full Time) | Placement India | FULL_TIME |
| Sales Executive (Full Time) | Mohammedi Polytech | FULL_TIME |
| Cardiac Anesthetist (full Time) | Pacific Asia Consulting Expertise | FULL_TIME |
| Firmware Engineer (Full Time) | Career Choice Solution | FULL_TIME |
| Project Manager (Full Time) | Atal Foundation | FULL_TIME |
| Manual Accountant (full Time) | Agarwal Job Placement | FULL_TIME |
| Telecaller - Full Time - Freshers | Advance Mobile Repairing Institute | FULL_TIME |
| Tester - Full Time - Freshers | Placement India | FULL_TIME |
| Telecaller - Full Time - Freshers | Yellow Umbrella Academy | FULL_TIME |
| Sales Executive (Full Time) | Mohammedi Polytech | FULL_TIME |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!