1,709,319+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Delivery Head

📑 Head of AI Services Delivery Location: Bangalore (on-site) | Reports to: Co-founders | Level: Director About DotKonnekt DotKonnekt is an Enterprise AI company and Google Cloud AI Partner with operations in India, UAE, and the US. We are a full-stack AI Solutions company – combining domain ontology, proprietary A ...

Lead Engineer

📑 ABOUT YUBI Yubi (formerly CredAvenue) is redefining global debt markets by freeing the flow of finance between borrowers, lenders, and investors — the world's possibility platform for the discovery, investment, fulfilment, and collection of any debt solution. In March 2022, we became India's fastest fintech unic ...

Technical Lead

📑 About the Role: We’re looking for a hands-on Lead Engineer who can own and drive large technical initiatives end to end. This role is ideal for someone who thrives in startup environments, is comfortable working with high autonomy, and can take an idea from a vague business ...

Chief technology officer

📑 Founding CTOSaraathi AI Private Limited | India (Remote-friendly) | Founding TeamAbout SaraathiEveryone needs someone to talk to yet millions of Indians have no one they can open up to without judgment. Saraathi.ai is an anonymous, AI-matched peer-support platform for emotional wellness, built for In ...

Senior mobile app dev react native

📑 We need a Senior Mobile App Lead Dev with 7+ years of experience to maintain, optimize, and extend our existing enterprise mobile application. This role requires hands-on expertise with camera-based scanning workflows (QR/barcodes) and libraries such as Vision Camera , AI integrations , and APIs.The ideal ca ...

Senior data engineer

📑 About the CompanyJMAN Group is a fast-growing data engineering & data science consultancy. We work primarily with Private Equity Funds and their Portfolio Companies to create commercial value using Data & Artificial Intelligence. In addition, we also work with growth businesses, large corporates, multination ...

Ai / ml architect

📑 Job Title: AI / ML Architect Location: Pune Experience required: 8+ years relevant The AI Engineer Architect plays a pivotal role in enabling safe responsible and enterprise ready AI adoption within the Exponential Engineer Program This role focuses on demystifying AI f ...

Generative AI Engineer

📑 About the Company QualiZeal, headquartered in Texas, USA, is a leading provider of AI-powered Quality Engineering services worldwide. With a diverse portfolio of digital transformation services including Quality Engineering, Digital Engineering, Advisory and Transformation, and Emergi ...

Senior forward deployed engineer

📑 About the RoleThis is not a traditional Sales Engineering role. You are a builder who sits at the intersection of engineering and revenue—the person who turns a prospect’s “can it do this?” into a live, working experience they can touch. You will own the technical narrative across the deal cycle by writing c ...

Sr Software Engineer

📑 Welcome to ACI Worldwide! As a global leader in the payments industry, we develop state-of-the-art solutions that revolutionize how the world transacts and does business. We have a proposition for you. Our Merchant Fraud Portfolio, recognized as an industry leader, serves a client base that encompasse ...

Generative AI Engineer

📑 About the Company QualiZeal, headquartered in Texas, USA, is a leading provider of AI-powered Quality Engineering services worldwide. With a diverse portfolio of digital transformation services including Quality Engineering, Digital Engineering, Advisory and Transformation, and Emerging Technol ...

Technical Lead

📑 About the Role: We’re looking for a hands-on Lead Engineer who can own and drive large technical initiatives end to end. This role is ideal for someone who thrives in startup environments, is comfortable working with high autonomy, and can take an idea from a vague business problem a ...

Technical Lead

📑 About the Role: We’re looking for a hands-on Lead Engineer who can own and drive large technical initiatives end to end. This role is ideal for someone who thrives in startup environments, is comfortable working with high autonomy, and can take an idea from a vague business problem a ...

Senior Mainframe Developer // Mumbai // 7 10 Yrs

📑 About the Company Our client is a leading IT Technology & Services Management MNC, dedicated to providing state-of-the-art IT solutions to millions of internal and external customers. As part of a major insurance group based in Germany and Europe, the company is committed to digital innovation in the insurance l ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise envi ...

Assitant professor MCA.

📑 INDIRA UNIVERSITY We Are Hiring Designation: Assistant Professor – Master of Computer Applications (MCA) Preferred Educational Qualification: Master of Computer Applications (MCA) / M.Tech. (Computer ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Data Engineer Lead

📑 Role OverviewWe are seeking aDelivery Leadto lead the end‑to‑end delivery of data platforms and web‑based data solutions. This role blendshands-on data engineering expertise with strong delivery ownership and people leadership .The ideal candidate will manage acros ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Chief Technology Officer

📑 Founding CTOSaraathi AI Private Limited| India (Remote-friendly) | Founding TeamAbout SaraathiEveryone needs someone to talk to yet millions of Indians have no one they can open up to without judgment. Saraathi.ai is an anonymous, AI-matched peer-support platform for emotional w ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...

Founding AI Platform Engineer

📑 This test must be taken to be considered for this position. Aegis is building an AI security and governance platform focused on discovering, classifying, risk-scoring, and enforcing policies for AI agents, AI scripts, and automation workflows across enterprise environments. W ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,709,319+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Delivery Head DotKonnekt Full-time
Lead Engineer Yubi Full-time
Technical Lead Novo Full-time
Chief technology officer Saraathi Full-time
Senior mobile app dev - react native Procure Full-time
Senior data engineer JMAN Group Full-time
Ai / ml architect Anonymous Full-time
Generative AI Engineer QualiZeal Full-time
Senior forward deployed engineer Interface.ai Full-time
Sr Software Engineer ACI Worldwide Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!