1,709,441+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic EngineerThe way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift.Elestio is the managed platform for open-source software: 400+ tools deployed and operated across 9+ ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic EngineerThe way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift.Elestio is the managed platform for open-source software: 400+ tools deployed and operated across 9+ ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic EngineerThe way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift.Elestio is the managed platform for open-source software: 400+ tools deployed and operated across 9+ ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic EngineerThe way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift.Elestio is the managed platform for open-source software: 400+ tools deployed and operated across 9+ ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

Senior Agentic Engineer

📑 Elestio is hiring a Senior Agentic Engineer The way we build software is changing fast, and we're looking for someone who's excited to build at the heart of that shift. Elestio is the managed platform for open-source software: 400+ tools deployed and operated across ...

.Net MVC Consultant

📑 .Net MVC Consultant - CREQ187416 Description Proficient in Azure Cloud Application Development, modernization, implementation, deployment and support of highly distributed applications leveraging .NET, C# and client technologies like JQuery, Angular/React. Azure API development and integration experienc ...

Programming.com Dot Net Architect Lead

📑 Job Title: Dot Net Architect Lead Location:Gurgaon Experience: 8+ Years About Company : Programming.com premier software solution and digital tra ...

Engineering Lead, AI Native Platforms

📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...

Technical Delivery Director

📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...

Director Technical Delivery

📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...

Senior Electronic Design Engineer

📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics. As an engineer joinin ...

Director Technical Delivery

📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...

Product Aligned Agentic Quality Engineering Lead (Automation & Agentic Ai)

📑 Project Role : Quality EngineerProject Role Description : Enables full stack solutions through multi-disciplinary team planning and ecosystem integration to accelerate delivery and drive quality across the application lifecycle. Performs continuous testing for security, API, and regression suite. Creates automat ...

Enterprise Architect

📑 Job Title: Enterprise Architect Experience: 18+ years Location: Chn/Hyd/Blg/Pune Domain: Banking Notice Period: Immediate to 45 days Job Description: Must be skilled in Java stack, Front end stack and op ...

Snowflake Developer (HR)

📑 Snowflake Developer (HR) - CREQ Description Data Engineers for HR Area (2 count) - eight plus years of experience (Very good in documenting Tech specifications, Ability to provide and work solutions rapidly. Good hands-on knowledge on the tech stack mentioned above, basic understanding of DWH /Data Models, Aggr ...

DVA

📑 We have planned walk in drive on 6th June in Pune. PFB details Interview Venue: , , - , Interview Process: • Shortlisting of profile • Technical Interview • Tool Test • HR discussion PFB job description Scope of Role- The DVA Engineer is responsible for Dimensional Variation Analysis and Tolerance sta ...

Snowflake Developer (HR)

📑 Snowflake Developer (HR) - CREQ193954 Description Data Engineers for HR Area (2 count) - eight plus years of experience (Very good in documenting Tech specifications, Ability to provide and work solutions rapidly. Good hands-on knowledge on the tech stack mentioned above, basic understanding of DWH /Data Models, ...

AWS EXPERT

📑 Job Description Responsibilities Understand the current application infrastructure and suggest changes to it.Define and document best practices and strategies regarding application deployment and infrastructure maintenance.Migrate our infrastruct ...

Software Engineer

📑 Labcorp is a global leader in diagnostic testing and drug development solutions, helping healthcare providers, researchers, and patients make informed decisions that advance care. Join us in our mission to improve health and improve lives. Labcorp is seeking a remote Full Stack Software Engineer </b ...

Software Engineer

📑 Labcorp is a global leader in diagnostic testing and drug development solutions, helping healthcare providers, researchers, and patients make informed decisions that advance care. Join us in our mission to improve health and improve lives.Labcorp is seeking a remote Full Stack Software Engineer ...

Technology Support Engineer

📑 Project Role : Technology Support EngineerProject Role Description : Resolve incidents and problems across multiple business system components and ensure operational stability. Create and implement Requests for Change (RFC) and update knowledge base articles to support effective troubleshootin ...

Staff Software Engineer, ROR

📑 Staff Software Engineer, ROR Looking for a Staff Full Stack Engineer with ...

Staff Software Engineer, ROR

📑 Staff Software Engineer, ROR Looking for a Staff Full Stack Engineer with ...

SAP Advanced ABAP, PI/CPI Technical Lead

📑 Who we areVOIS (Vodafone Intelligent Solutions) is a strategic arm of Vodafone Group Plc, creating value for customers by delivering intelligent solutions through Talent, Technology & Transformation.As the largest shared services organisation in the global telco industry with 30, ...

Software Engineer Agentic AI Platform

📑 Rivvun AI is looking for a hands-on AI Developer to design, build, and deploy the next generation of intelligent applications from the ground up. We aren't just plugging into APIs— we are building a scalable, secure, and reusable enterprise AI platform. Key Responsibili ...

Data Quality Engineer

📑 Description: Extensive experience in Big Data space (Hadoop Stack like M/R, HDFS, Pig, Hive, HBase, Flume, Sqoop, NoSQL stores like Cassandra, HBase etc.) across Fractal and contributes to open-source Big Data technologies. Write and tune complex Java, MapReduce, and Hive jobs. ...

Software Engineering Senior Analyst

📑 **INTRODUCTION TO EVERNORTH:** Evernorth Health Services India, established in Hyderabad in 2024, is an innovation hub for Evernorth Health Services, the pharmacy, care and benefits division of The Cigna Group. The innovation hub will support innovation-focused areas, such as generative AI, product deve ...

User Experience Engineer (UXE) (7 8 yrs experience)

📑 **Hungry, Humble, Honest, with Heart.** **The Opportunity** We are looking for a Senior User Experience Engineer (MTS4) to join our UX/UI team. You will work at the intersection of design and technology — collaborating with designers, researchers, and engineers to prototype, validate, and deliv ...

Client Facing AI Engineer

📑 Role SummaryThe Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...

Agentic Systems Developer

📑 Role SummaryThe Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...

AI/FDE Engineer

📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...

AI Solutions Architect

📑 Role SummaryThe Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...

Ai/Fde Engineer

📑 Role SummaryThe Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...

Learning Experience Architect (LXA) | Full time, Onsite Noida | Open to India based candidates only

📑 Learning Experience Architect (LXA) | Full-time, Onsite - Noida | Open to India-based candidates only Position type: Full-time Employee (Client-facing | Senior Individual Contributor with Team Leadership) Location: Onsite - Noida, India At Infopro Learning, we design learning that dri ...

B.Sc/M.Sc Graduates from WEST BENGAL Only: SigiloTech’s Paid Internship to Full Time Opportunity!

📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! APPLY ONLY IF YOU A ...

Project Manager Professional Services | Full time, Onsite Noida | Open to India based candidates only

📑 Project Manager - Professional Services | Full-time, Onsite - Noida | Open to India-based candidates only Location: Noida, IndiaEmployment Type: Full-time | Onsite Why this role exists We are hiring an experienced Project Manager </st ...

General Practitioner (GP), Part time/Sessional & Full time, WA Geraldton Are you our n

📑 Are you a GP looking to follow your passion, have a new challenge and work within an exciting team? headspace Geraldton is seeking expressions of interest from GPs interested in working part-time (as little as half a day per week) to offer primary health care to young people from our ...

Maintenance Electricians | Day and Night Shift | Pharmaceutical Industry | Permanent Full time | South East Melbourne

📑 Maintenance Electricians | Day and Night Shift | Pharmaceutical Industry | Permanent Full-time | South East Melbourne South East Melbourne Permanent Full-time role Competitive remuneration and bene ...

Registered Psychologists / Accredited Mental Health Social Workers, Part time/Sessional & Full time, NSW Bankstown

📑 headspace works from an early intervention and prevention framework with young people and their families who have emerging mental health issues. We deliver four core services which include general health, mental health support, vocational services, and alcohol and other drug services ...

APM/PM/SPM Civil/Mechanical/Electrical for Data Centre at Jamnagar (Gujarat) Full time

📑 Company Description Who is Turner & Townsend? All over the world people are using buildings, infrastructure, and assets we helped to deliver. It could be the hospital they work in, the railway they travel on every day, the fuel that powers their car or the dat ...

Data Centre Cost Managers & Project Managers Australia Expression of Interest All Levels Full time

📑 Company Description Turner & Townsend is a global professional services company with over 22,000 people in more than 60 countries.Working with our clients across real estate, infrastructure, energy and natural resources, we transform together delivering outcomes that improve peo ...

Sap fico functional consultant| location: mumbai| employment type: full time| experience: 6–8 years

📑 SAP FICO Functional ConsultantLocation: MumbaiEmployment Type: Full-TimeExperience: 6–8 YearsAbout the RoleWe are looking for an experienced SAP FICO Functional Consultant to manage and support Finance & Controlling processes across implementation, rollout, enhancement, incident management, a ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,709,441+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time
Senior Agentic Engineer Elestio Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!