📑 We are looking for a Staff Software Engineer who will design and build scalable full-stack software systems that deliver measurable business value. You will work directly with teams across Commercial, Manufacturing, and R&D to discover problems, navigate ambiguity, a ...
📑 Job description: 5-15 years Backend/Full Stack Developer with hands-on experience in Python (FastAPI) for backend development and Next.js for frontend development. Primary skill must be backend. The ideal candidate should be comfortable working across the full stack, bui ...
📑 • 4-6 years of proven IT Experience • Full-Stack Development Expertise • Minimum, one year Javascript, proven Experience • Excellent in Java Springboot JavaScript and OOP JavaScript TypeScript ES6 • Proficient in web development • Java Springboot HTML CSS JavaScript Typescript • Sol ...
📑 Job Title: Principal Full Stack AI Engineer Job Location: WFH/Remote / Preference Gurugram Reporting By: Team of Developers Experience: 8+ years 8+ years of work experience with JavaScript 8+ ...
📑 About Algotale At Algotale, we believe in the transformative potential of data to reshape industries, drive innovation, and create unparalleled value. Established in 2020 by a team of passionate and visionary professionals, Algotale set out to re ...
📑 Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utili ...
📑 Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...
📑 You'll be part of global teams across Bupa markets You'll get to work on building innovative digital health solutions About Our Client Bupa is a leading international healthcare company, established in 1947. Job Description Lead the devel ...
📑 Job Title: Lead Full Stack AI Engineer Job Location: WFH/Remote / Preference Gurugram Reporting By: Team of Developers Experience: 8+ years 8+ years of work experience with JavaScript 8+ yea ...
📑 • 4-6 years of proven IT Experience • Full-Stack Development Expertise • Minimum, one year Javascript, proven Experience • Excellent in Java Springboot JavaScript and OOP JavaScript TypeScript ES6 • Proficient in web development • Java Springboot HTML CSS JavaScript Typescript • Sol ...
📑 Company Summary First American (India) is a GCC (Global Capability Center) of the First American Financial Corporation (NYSE: FAF) family of companies. FAI is a proud member of the FORTUNE 500 companies and has been amongst the Fortune 100 Best Companies to Work For® list for eight conse ...
📑 Who we are looking for: As a Senior Lead Developer, the candidate will be responsible for designing and developing solutions for GTS Integration Services team. The candidate must have 10+ years of experience in developing web applications in Java, JavaScript frameworks, Spring MVC and Microserv ...
📑 Who we are looking for We are seeking an Officer who will report directly to the Assistant Vice President . This role will primarily focus on Full Stack development for SSCD projects , contributing to the design, development, and maintenance of business‑critical applicatio ...
📑 Job Description Full-Stack Developer Internship Location: Bengaluru Employment Type: Internship (3-6 months) Experience Level: Entry-Level/Recent Graduate About Acowale We're building Acodash - th ...
📑 Full-Stack Developer Internship Location: Bengaluru Employment Type: Internship (3-6 months) Experience Level: Entry-Level/Recent Graduate About Acowale We're building Acodash - the world's first AI-powered ...
📑 Position: Senior Java Full Stack Developer Company: Infotel UK Location: Liverpool, UK Infotel UK, a premier consulting firm specializing in information technology and digital transformation, is seeking a dynamic and experienced Senior ...
📑 Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utili ...
📑 Description We are seeking a Java Full Stack Angular Developer to join our team. As a Java Full Stack Developer, you will play a pivotal role in designing and developing high-quality software applications. You will be responsible for implementing and maintaini ...
📑 Great vacancy Lead Software Engineer hiring now <meta content=AoeiQ3Ow/BnNjoZ1k2kL0ix9SXzlnjm47YFisfuVAskKVTny0NGo4CEkVQNe1OCi48F77X4EZc6G69wDDJtAlggAAABleyJvcmlnaW4iOiJodHRwczovL3NhbGVzZm9yY2Utc2l0ZXMuY29tOjQ0MyIsImZlY ...
📑 Who We Are At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a l ...
📑 Description Position at DNEG Core Services is looking for a Full Stack Developer to join its Artist Tool project within its Data Services workstream.The Core Services group provides foundational technologies to other technology groups within DNEG. We are a team of software developers ...
📑 Priority 1: Full Stack (Python and React) - Position -2 Must-have skills: Total Experience must be 8 years Python Min 5 years in Python React Min 4 years in React AI capabilities Experience like LLM s, RAG, MCP ...
📑 Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utili ...
📑 Experience: 4 to 7 years Relevant Experience: 4+ years Location: All Genpact loc. (Noida pref.) Mode: 6 Month contract + ext. For this role, looking for a brilliant Full Stack Software Engineer to de ...
📑 About the Role We are seeking a highly skilled 5 Years of Full Stack Developer to design, develop, and maintain scalable web applications. The ideal candidate will have strong expertise in both front-end and back-end technologies, with the ability to work across the full software development lifecycle. ...
📑 JOB DESCRIPTION Job Title Software Technologist - Java Full StackJob Description Java Full Stack Developer Philips is a global leader in health technology, dedicated to improving lives through meaningful innovation. One of our five core businesses, ...
📑 Location: India (Remote) Experience: 4+ years At DiligenceVault , we've built the leading technology platform transforming how due diligence is conducted globally. Our platform helps organizations streamline and digitize highly manual diligence workflows through automation, data intelligence, and s ...
📑 About the Role We are seeking a highly skilled Senior Full Stack Developer who can design, develop, and deliver high-quality software solutions across the full technology stack.This role requires strong technical expertise, problem-solving skills, and the ability to work collaboratively with cross-fun ...
📑 This role is for one of the Weekday's clients Salary range: Rs - Rs (ie INR 12-16 LPA) Min Experience: 7 years Location: Pune, Bengaluru, Chennai, Coimbatore JobType: full-time We are seeking a skilled Java Full Stack Developer with ...
📑 About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
📑 Job Title: Principal Full Stack AI Engineer Job Location: WFH/Remote / Preference Gurugram Reporting By: Team of Developers Experience: 8+ years 8+ years of work experience with JavaScript 8+ ...
📑 Full-Stack Data Engineer - APO Ga terugApplyEneco - Rotterdam > 5 jaar Data & AI, Tech €83.000 - €117.000 Deel op social media:Full-Stack Data Engineer - APO Eneco - Rotterdam Data & AI, Tech <li ...
📑 Job Title: Full Stack Developer (React + Node.js + AWS) Experience: 7–10 YearsLocation: Bangalore / Pune Job Summary: We are seeking an experienced Full Stack Developer with strong expertise in React.js, Node.js, and AWS to design, develop, and maintai ...
📑 You may know McCormick as a leader in herbs, spices, seasonings, and condiments – and we’re only getting started. At McCormick, we’re always looking for new people to bring their unique flavor to our team. McCormick employees – all 14,000 of us across the world – are what makes this company a g ...
📑 Innovation is and will always be the core of SAP Fioneer, and it is the promise of why we were spun out of SAP:Agility, innovation, and Delivery. SAP Fioneer builds on a heritage of outstanding technology and a deep understanding of corporate and consumer demands. At the heart of it all it is simple: W ...
📑 The Applications Development Intermediate Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute ...
📑 WHAT YOU DO AT AMD CHANGES EVERYTHING At AMD, our mission is to build great products that accelerate next-generation computing experiences—from AI and data centers, to PCs, gaming and embedded systems. Grounded in a culture of innovation and collaboration, we believe real progress com ...
📑 At eBay, we're more than a global ecommerce leader — we’re changing the way the world shops and sells. Our platform empowers millions of buyers and sellers in more than 190 markets around the world. We’re committed to pushing boundaries and leaving our mark as we reinvent the future of ecommerce for enthusias ...
📑 We’re Hiring: Full Stack Lead (Python + React | AI-Driven Development) Location: Hyderabad Job Type: Full-Time Experience: 6+ Years We are looking for an experienced Full Stack Lead who is passionate about building scalable applications and ...
📑 Company Description Organizations everywhere struggle under the crushing costs and complexities of “solutions” that promise to simplify their lives. To create a better experience for their customers and employees. To help them grow. Software is a choice that can make or break a business ...
📑 About the Role We are seeking a highly skilled Senior Full Stack Developer who can design, develop, and deliver high-quality software solutions across the full technology stack. This role requires strong technical expertise, problem-solving skills, and the ability to work collaboratively with cross-fu ...
📑 We are looking for a talented and motivated Senior Full Stack Developer ( Backend Heavy) to join our engineering team. In this role, you will architect, build, and maintain scalable web applications that power our digital commerce ecosystem. You will work across the entire stack — from designing RESTful APIs on ...
📑 At Marketplace, our mission is to help readers turn their aspirations into reality. We arm people with trusted advice and guidance, so they can make informed decisions they feel confident in and get back to doing the things they care about most. We are an experienced team ...
📑 About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...
📑 About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we con ...
📑 Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) About Fold Health Fold Health is building a ...
📑 Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides expertise in one or more ...
📑 Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...
📑 We are looking for an experienced Senior Full Stack Developer who can handle both front-end and back-end development, contribute to API integrations, and mentor junior developers. This is a fully remote position. Job Responsibilities Build and maintain scalable web applic ...
📑 We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description: Responsibilities: Front-End Development Excellence: </p ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,378+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Full Stack Gen AI Developer | Confidential | Full-time |
| Full Stack Developer | Hyderabad – Hybrid | Innominds | Full-time |
| Full stack ReactJS Java Developers | Anicalls (Pty) Ltd | Full-time |
| Principal Full-stack AI Engineer | United HR Solution | Full-time |
| ALGOTALE - WonderBotz ( Full Stack Developer) | Nexthire | Full-time |
| Senior Java Full Stack Developer | Epam | Full-time |
| Software Engineer - Full Stack Development | 5100 Kyndryl Solutions Private Limited | Full-time |
| Technical Lead - Full Stack Developer | Michael Page | Full-time |
| Lead Full Stack AI Engineer | United HR Solution | Full-time |
| Full Stack Java Software Engineer | Anicalls (Pty) Ltd | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!