📑 About Position:We are seeking an experienced Senior Software Engineer to design and build scalable, AI-driven payment solutions that power social impact initiatives. This role focuses on developing secure, reliable, and high-performance payment platforms integrated with th ...
📑 The roleWe're looking for a senior Tech Lead who combines deep hands-on experience with the ability to lead a team and drive delivery. You'll own the day-to-day execution of our engineering function - managing a cross-functional team of backend, frontend, DevOps engineers, and Product ...
📑 Lead full stack Developer at Pulp Strategy Experience - 8 To 10 Years Below that do not apply Budget - 10 to 12 LPA Immediate joiner Location: New Delhi Work Mode: Onsite Experience: 8 to 10 Years (minimum 3 years leading a team) Employment Type: Full-Time ...
📑 Company Description Zeen Web Solutions is a creative digital agency focused on building innovative websites, robust applications, and AI-driven solutions for clients across industries. The team brings together designers, developers, and strategists who collaborate to transform ideas into impactful dig ...
📑 Company Description Zeen Web Solutions is a creative digital agency focused on building innovative websites, robust applications, and AI-driven solutions for clients across industries. The team brings together designers, developers, and strategists who collaborate to transform ideas into impa ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The roleLead Full Stack Platform Engineer (React · Node.Js · AWS · Bootstrap D ...
📑 Why MizuhoAt Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique fi ...
📑 Java Developer – Cloud Native & Kubernetes Location: Chennai Experience: 3–8 Years Required Skills: Strong experience in Java Expertise in Spring Boot, Spring MVC Hands-on experience in Cloud Native Strong understanding of Kubernetes ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The role Lead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Design System). ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The role Lead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Design System). Remo ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The role Lead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Design System). ...
📑 What impact will you make?Every day, your work will make an impact that matters, while you thrive in a dynamic culture of inclusion, collaboration and high performance. As the undisputed leader in professional services, Deloitte is where you will find unrivaled opportunities to ...
📑 Company Description Zeen Web Solutions is a creative digital agency focused on building innovative websites, robust applications, and AI-driven solutions for clients across industries. The team brings together designers, developers, and strategists who collaborate to transform ideas into impa ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The role Lead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Desig ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The roleLead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Design Syst ...
📑 Lead full stack Developer at Pulp StrategyExperience - 8 To 10 Years Below that do not apply Budget - 10 to 12 LPA Immediate joinerLocation: New Delhi Work Mode: Onsite Experience: 8 to 10 Years (minimum 3 years leading a team) Employment Type: Full-Time< ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The role Lead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Design System). ...
📑 Title: Senior Engineer / Lead- .Net + ReactLocation: Chennai, Bangalore, HyderabadNotice Period : ImmediateWho we areTiger Analytics is a global leader in AI and analytics, helping Fortune 1000 companies solve their toughest challenges ...
📑 Mindrift is looking for skilled Full-Stack Web App Developers (JavaScript/TypeScript + Python or Node) to join the Tendem project () and build interactive browser-based application ...
📑 Skills required 8+ Experience Expert in HTML-5, CSS-3 Expert with frontend development stack React18 & 19/Typescript/RXJS Experience with backend technologies like SpringBoot, Core Java Experience in CI/CD environments- Devops ...
📑 Great vacancy Senior Software Engineer - Full stack Developer hiring now<script src=/recruit/jslibrary/1755174923258/sfdc/main. ...
📑 Job Description – Junior Full Stack Engineer (AI Specialist) Location: Kochi / Onsite Experience: 4–8 years Role Overview We are looking for a motivated Full Stack Engineer with AI API integration skills to support mission-critical applications.The role requires flexibility ...
📑 We are a team of Engineers, Designers, Thinkers, Product Managers, Problem solvers and more. We are bound by our commitment to help teams succeed with our culture of learning & innovation. We seek solutions for tomorrow and build them today. We believe in ‘Driving Outcomes Through Actions’. Treating our ...
📑 Strong experience with Python (Lead level): REST APIs, data pipelines, asynchronous programming, and integrations.Hands-on experience with SQL and working with both structured and unstructured data.Experience with React (Mid level): Capable of maintaining ...
📑 <p style="text-align:start; text-indent:0px; -webkit-text-stroke-width:0px">Job Title: Full Stack Developer (React + Node.js + SQL)<br /> Experience: 6 - 8 years</p> <p style="text-align:start; text-indent:0px; -webkit-text-stroke-width:0px">Shift Ti ...
📑 Your tasksDevelop and maintain Spring Boot microservices delivering secure REST APIs, ensuring clean code, scalability, and adherence to OWASP security best practices.Build and enhance UI components in Angular (18+), complementing backend services and supporting a smooth user ex ...
📑 Skills required 8+ Years Experience Expert in HTML-5, CSS-3 Expert with frontend development stack Angular18 & 19/Typescript/RXJS Experience with backend technologies like SpringBoot, Core Java Experience in CI/CD environments- <b ...
📑 At TechBiz Global, we are providing recruitment service to our TOP clients from our portfolio. We are currently seeking a Full-stack developer to join one of our <span style=co ...
📑 Position: Senior Full Stack Engineer (Java/React) Location: Remote from LATAM Contract Type: Full-time vendor Time Zone Alignment: APAC ...
📑 **Who We Are** At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a lasti ...
📑 **Who We Are** At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a lasti ...
📑 **Who We Are** At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a lasti ...
📑 **Who We Are** At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a lasti ...
📑 **Introduction**As a Fullstack Software Developer, you will be part of a core product development team responsible for designing, building, and scaling high-quality software products. You will work across the full technology stack — from designing intuitive front-end experiences to building performant and se ...
📑 At Medtronic you can begin a life-long career of exploration and innovation, while helping champion healthcare access and equity for all. You’ll lead with purpose, breaking down barriers to innovation in a more connected, compassionate world. **A Day in the Life**We are seeking an established and hi ...
📑 **Requisition number:** 2359133**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **About this role:** Wells Fargo is seeking a... **In this role, you will:** + Lead moderately complex initiatives and deliverables within technical domain environments+ Contribute to large scale planning of strategies+ Design, code, test, debug, and document for projects and p ...
📑 **About this Role:** Wells Fargo is seeking a **Lead Software Engineer.** **In this role, you will:** + Lead complex technology initiatives including those that are companywide with broad impact+ Act as a key participant in developing standards and companywide best practices for e ...
📑 **About this role:** Wells Fargo is seeking a Senior Software Engineer. **In this role, you will:** + Lead moderately complex initiatives and deliverables within technical domain environments+ Contribute to large scale planning of strategies+ Design, code, test, debug, and docu ...
📑 **About this role:** Wells Fargo is seeking a... **In this role, you will:** + Lead moderately complex initiatives and deliverables within technical domain environments+ Contribute to large scale planning of strategies+ Design, code, test, debug, and document for projects and p ...
📑 We are looking for a Full Stack Software Engineer with strong **UI engineering, web development** , and **Azure cloud experience** to build scalable, high quality digital applications. The ideal candidate will have hands-on proficiency in React/Vue, **API development, cloud-native patterns, and Azure service ...
📑 We are looking for a Full Stack Software Engineer with strong **UI engineering, web development** , and **Azure cloud experience** to build scalable, high quality digital applications. The ideal candidate will have hands-on proficiency in React/Vue, **API development, cloud-native patterns, and Azure service ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,382+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Full Stack AI Developer, Financial Technology | Persistent Systems | Full-time |
| Full-Stack Architecture and AI Lead | Confidential | Full-time |
| Lead Full Stack Developer -CMS Project | Pulp Strategy | Full-time |
| Senior Full Stack Developer (... | Zeen web solutions | Full-time |
| Senior Full Stack Developer (... | Zeen web solutions | Full-time |
| Lead Full Stack Platform Engineer(S) | MeridianSquare | Full-time |
| Full Stack Software Engineer (.NET/Azure) | Mizuho | Full-time |
| Application Support - Java Full... | Jobtome | Full-time |
| Lead Full Stack Platform Engineer(s) | MeridianSquare | Full-time |
| Lead full stack platform engineer(s) | MeridianSquare | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!