📑 Who we are looking forWe are seeking an Officer who will report directly to the Assistant Vice President. This role will primarily focus on Full Stack development for SSCD projects, contributing to the design, development, and maintenance of business‑critical applications.</ ...
📑 Job Description<span class=highlight style=background-color ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 Job Description: SDE3 / Principal Engineer Location: On-Site Hyderabad About the Role:We are seeking a highly skilled SDE3 / Principal Engineer to join our dynamic engineering team. This is not a r ...
📑 Responsibilities:1. Develop front end website architecture using Angular JS, ReactJS, and HTML/CSS2. Design and develop backend services using Spring Boot3. Integrate user-facing elements with server-side logic using Rest APIs4. Create and maintain technical documentation5. Troubleshoot ...
📑 Full Stack Developer (Backend/.NET)Millennium is seeking a skilled Full Stack Developer (Backend/.NET) to build and support complex inbound and outbound integrations across corporate accounting, partnership accounting, and financial systems. The ideal candidate brings strong backend engineering expertise, wit ...
📑 Job DescriptionWe’re Hiring: Full Stack Lead (Python + React | AI-Driven Development) Location: Hyderabad Job Type: Full-Time Experience: 6+ YearsWe are looking for an experienced ...
📑 Position Description: Company Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and bu ...
📑 Our storyAt Alight, we believe a company’s success starts with its people. At our core, we Champion People, help our colleagues Grow with Purpose and true to our name we encourage colleagues to “Be Alight.”Our Values:Champion People – be empathetic and help create a p ...
📑 Candidate should be able to: Ensure quality by performing thorough testing and leveraging peer reviews for your work and the work of cross-functional teams Implement excellent end-user experiences, continually raising the bar on functionality, usability, and simplicity Drive robust, maintainable, ...
📑 About Company: It is a data and analytics company Experience: 3 to 8Years Location: Bangalore Title: Python Developer Notice Period: Immediate to 30 Days </p ...
📑 Job Description We are looking for a react native developer with 1-2 years of experience. Responsibilities.1. Develop and build mobile apps for iOS & Android devices using React Native Framework.2. Integrate Web API into mobile app code base.3. Manage 3rd Party API Integrations ...
📑 About the Company Vagaro is a global leader in cloud-based business management software, serving the salon, spa, beauty, fitness, and wellness industries. Our platform enables businesses to manage scheduling, payments, marketing, and operations fro ...
📑 Position: Python Fullstack Developer Exp: 7-10 Years [Minimum 5 yrs must be in Python] Location: Hyderabad Working Mode: WFO ...
📑 Senior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. Role: Senior Architect (Ful ...
📑 .Full stack Lead -React Node - CREQ191191 Description Development and implementation of web applications using ReactJS, NodeJS (with NestJS or ExpressJS), and TypeScript/JavaScript. Design, optimize, and manage PostgreSQL databases, including schema design and data migration/transformation. Implement b ...
📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
📑 Job Description :We are hiring an engineer of Full Stack Development with a strong frontend and backend background in cross-platform software engineering and experience with delivering projects. This opportunity will support the transformation of our industry standard order and delive ...
📑 Company: 8 Views Website: Position: Full Stack Developer Location: Hyderabad (Onsite) Work Hours: 9:30 AM – 6:30 PM (Monday to Friday)</p ...
📑 Technical Lead - Java Full Stack IT (Information Technology) Permanent contract Bangalore, India Hybrid Reference 250009IB Start date Immediately Publication date 2025/06/14 Responsibilities Profile RequiredResponsibilitiesResponsible for understandi ...
📑 About Company It is one of the leading IT solutions providers with a focus on automotive, fintech, and manufacturing industries Experience 12 to 15 years Location Bangalore (WFO) Job Description:</st ...
📑 Job DescriptionThe Staff Web Engineer – Full Stack (Frontend Heavy) will play a key role in building scalable, consumer-facing web applications within the Marketplace domain in Experian Consumer Services. This role focuses on strong frontend development while having a good understanding o ...
📑 Job description We are looking for a skilled Senior Software Engineer to play a key role in our front-end development using ReactJS. This role involves enhancing user interface components and implementing well-conceived designs into our AI-powered SaaS solutions. You will collaborate with ...
📑 Job TitleSoftware Engineering & Development - Java Full Stack, OfficerRole Summary & Role DescriptionJava Full Stack Developer will contribute to the development, enhancement and maintenance of financial applications as a member of an agile scrum team. This is an oppo ...
📑 Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
📑 We’re looking for an SDE-2 Full Stack Engineer who is comfortable working across backend and frontend, but brings strong backend depth in building scalable, event-driven systems. You’ll work on high-throughput pipelines, real-time processing, and customer-facing features while owning problems ...
📑 Raven is a YC-backed startup (S22) building AI assistants for manufacturing plants. We're taking decades of manufacturing expertise and combining it with AI to solve real operational problems. Backed by top VCs, we're a small, focused team working to make industrial operations safer, smarter, and more efficie ...
📑 Experience: 69 Years (Minimum 5 years relevant)Location: Bangalore (Mandatory 3 days office)Engagement: C2HMode: Hybrid (3 days WFO)Notice Period: Immediate Joiners Only< ...
📑 Full-Stack Data Engineer - APO Ga terugApplyEneco - Rotterdam> 5 jaarData & AI, Tech€83.000 - €117.000 Deel op social media:Full-Stack Data Engineer - APOEneco - Rotterdam<li ...
📑 Job Responsibilities: To design, develop, modify, and implement software programming for products (both internal and external) with focus on surpassing customers expectations by achieving high quality and on time delivery. Responsible for ensuring the overall functional quality of the released product on all req ...
📑 AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Work awards. WHY JOIN US If ...
📑 AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Work awards. WHY JOIN US If ...
📑 AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Work awards. WHY JOIN US If ...
📑 AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Work awards. WHY JOIN US If ...
📑 AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Work awards. WHY JOIN US If ...
📑 AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Work awards. WHY JOIN US If ...
📑 Full-Stack Developer Internship Location: Bengaluru Employment Type: Internship (3-6 months) Experience Level: Entry-Level/Recent Graduate About Acowale We're building Acodash - the world's first AI-powered Smart Operating System for Business. One simple dashboard replaces every digital tool a business needs, in ...
📑 Were Hiring: Full Stack Lead (Python + React | AI-Driven Development) Location: Hyderabad Job Type: Full-Time Experience: 6+ Years We are looking for an experienced Full Stack Lead who is passionate about building scalable applications and leveraging AI-powered development practices to improve speed, quality, an ...
📑 Hiring: Application Developer Python Full Stack (Open Source + Azure) Location: Bangalore (Onsite) Experience: 810+ Years (Mandatory 8+ years Python Full Stack) Budget: Up to 21 LPA We are looking for a highly skilled Python Full Stack Developer with strong experience in modern web development, Azure cloud serv ...
📑 Senior .Net Full Stack DeveloperJoining Type- Immediate Joiners PreferredYears Of Experience- 10+ Years.Location-Viman Nagar Pune.<stro ...
📑 Senior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. Role: Senior Architect (Full Stack + AWS) Experience: 15+ Years Location: Hyderabad Notice Period: Immediate 30 ...
📑 We are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have hands-on experience in backend development using Spr ...
📑 **Job Description** **About AutoZone** AutoZone is the nation's leading retailer and a leading distributor of automotive replacement parts and accessories with more than 6,000 stores in the US, Puerto Rico, Mexico, and Brazil. Each store carries an extensive line of cars, sport utility vehicles ...
📑 We’re in the middle of an exciting transformation: evolving from large, full‑stack applications to headless, API‑first, cloud‑native, microservice‑based architectures. To help us get there, we’re looking for experiences Full‑Stack Developers who are excited by platform engineering, modern architecture, and build ...
📑 At TechBiz Global, we are providing recruitment service to our TOP clients from our portfolio. We are currently seeking a Full-stack developer to join one of our clients ' team. If you're looking for an exciting opportunity to grow in a innovative environment, this could ...
📑 Job Description – Junior Full Stack Engineer (AI Specialist) Location: Kochi / Onsite Experience: 4–8 years Role Overview We are looking for a motivated Full Stack Engineer with AI API integration skills to support mission-critical applications. The role requires flexibility to work in 24x7 rotation ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The roleLead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap D ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The roleLead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap D ...
📑 Title: Senior Engineer / Lead- .Net + ReactLocation: Chennai, Bangalore, HyderabadNotice Period : ImmediateWho we areTiger Analytics is a global leader in AI and analytics, helping Fortune 1000 companies solve their toughest challenges ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The role Lead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Desig ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,389+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Full Stack developer - Senior Manager | State Street | Full time |
| .Net/C++ Full stack developer | Pratiti Technologies Pvt. Ltd. | Full-time |
| Senior Software Engineer (Full-Stack) | The Nielsen Company | Full Time |
| Beacon.li- Senior Full Stack Engineer | Nexthire | Full Time |
| Full Stack Java Developer Bangalore | Right Fit Resources | Full-time |
| Full Stack Developer (Backend/.NET). | Millennium Management | Full-time |
| Full Stack Lead (Python + React | | Vrinda International | Full-time |
| Java Full Stack - Mid Level | CGI | Full Time |
| .Net Angular Full Stack developer | Alight | Regular |
| Lead Java Full stack Developer | Anicalls (Pty) Ltd | Full Time/Permanent |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!