📑 Location: Bangalore out ring road, 3 days mandatory work from office at client location Experience Range 6 - 10 Years Job Type: 6 months contract + ext Need Immediate joiners only <stro ...
📑 Great vacancy Senior Software Engineer hiring now <meta content=AoeiQ3Ow/BnNjoZ1k2kL0ix9SXzlnjm47YFisfuVAskKVTny0NGo4CEkVQNe1OCi48F77X4EZc6G69wDDJtAlggAAABleyJvcmlnaW4iOiJodHRwczovL3NhbGVzZm9yY2Utc2l0ZXMuY29tOjQ0MyIsImZ ...
📑 Job Description: SDE3 / Principal Engineer Location: On-Site Hyderabad About the Role:We are seeking a highly skilled SDE3 / Principal Engineer to join our dynamic engineering team. This is not a role for someo ...
📑 Are you ready to power the future? At SolarEdge (NASDAQ: SEDG), we're a global leader in smart energy technology, with over 4,000 employees, offices in 34 countries, and millions of installations worldwide. Our innovative solutions include solar inverters, battery storage, ba ...
📑 Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...
📑 Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides e ...
📑 Requirement Details are below: Title: Senior Full Stack Developer Banking Domain Location: Thousand Lights, Chennai Work Mode: Onsite (5 Days) | Sat/Sun Week Off Department: Software Development Positions: 1 Employment Type: Full Time Remote: No </ ...
📑 About Netskope Today, there's more data and users outside the enterprise than inside, causing the network perimeter as we know it to dissolve. We realized a new perimeter was needed, one that is built in the cloud and follows and protects data wherever it goes, so we started Net ...
📑 Full Stack Developer Job Location: Gurgaon Work Mode: 5 days Onsite Java, Spring Boot, Angular or ReactJS, AWS or Azure Cloud, REST APIsJavaScript / T ...
📑 Tätigkeitsbereich:IT/TelekommunikationFachabteilung:SW Release Management-1Gesellschaft:Mercedes-Benz Research and Development India Private LimitedStandort:Mercedes-Benz Research and Development India Private Limited, BangaloreStartdatum:sofortVeröffentlichungsdatum:..6Stellennummer:MER3YMQArbeitszeit:Vollzeit ...
📑 About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...
📑 Engineering Lead You should be required to be proficient in Java/J2EE tech stack. Must have expertise in “Agile” Software development methodology. Good hands-on designing and development using SOLID Design principles. Exposure to new age tech ...
📑 About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...
📑 About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services including local and national court r ...
📑 Job Title Software Engineering & Development - Java Full Stack, Officer Role Summary & Role Description Java Full Stack Developer will contribute to the development, enhancement and maintenance of financial applications as a member of an agile scrum team. This is a ...
📑 About Company: It is a data and analytics company Experience: 3 to 8Years Location: Bangalore Title: Python Developer Notice Period: Immediate to 30 Days </p ...
📑 Company Overview Docusign brings agreements to life. Over 1.5 million customers and more than a billion people in over 180 countries use Docusign solutions to accelerate the process of doing business and simplify people’s lives. With intelligent agreement management, Docusign unleashes business-critical data tha ...
📑 Senior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. Role: Senior Architect (Full Stack + AWS) Experi ...
📑 Candidate should be able to: design and present solutions that conform to the banks technology strategy and road map. oversee the execution of designed solutions by the development team. create build/package scripts for deploying applications using GitHub, Jenkins, Artifactory, and Ansible. ...
📑 About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders ...
📑 Job Summary Synechron is seeking a skilled Full Stack Developer with extensive experience in Node.js and React.js to support the development of scalable, high-performance enterprise applications. This role involves designing, developing, and maintaining robust front-end and back-end systems, integ ...
📑 Some careers shine brighter than others. If you’re looking for a career that will help you stand out, join HSBC and fulfil your potential. Whether you want a career that could take you to the top, or simply take you in an exciting new direction, HSBC offers opportunities, support and rewards that will ...
📑 Senior Software Engineer - Full stack Location: Noida, UP, IN BCR (Barco Control Rooms) The Barco Control Rooms business unit is making workflow and visualization solutions for the Control Room market since to help operators collect, visualize and share c ...
📑 Position Description: Company Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and busi ...
📑 Job DescriptionWe are looking for a talented Senior Full Stack Engineer to join our growing global team at Sectigo. We are hiring a backend-leaning Senior Full-Stack Software Engineer to help build, test, and operate a modern SaaS platform spanning Perl, Go, and TypeScript/Vue services. The p ...
📑 Job Title: Full Stack Developer (React + Node.js + AWS) Experience: 7–10 YearsLocation: Bangalore / Pune Job Summary: We are seeking an experienced Full Stack Developer with strong expertise in React.js, Node.js, and AWS to design, develop, and maintai ...
📑 This role is for one of the Weekday's clients Salary range: Rs - Rs (ie INR 12-16 LPA) Min Experience: 7 years Location: Pune, Bengaluru, Chennai, Coimbatore JobType: full-time We are seeking a skilled Java Full Stack Developer with ...
📑 We are seeking a Full Stack Software Engineer with strong expertise in Node.js, React.js, and Generative AI integrations . You will be responsible for building scalable digital products and embedding AI-driven capabilities into applications. Key Responsibili ...
📑 About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
📑 Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...
📑 Job Description Architect, design, and develop scalable, high-performance backend systems using Java and AWS. Build and maintain cloud-native microservices and API-driven platforms (REST/GraphQL). Contribute to end-to-end solution design across backend services and fr ...
📑 About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
📑 Job Title: Principal Full Stack AI Engineer Job Location: WFH/Remote / Preference Gurugram Reporting By: Team of Developers Experience: 8+ years 8+ years of work experience with JavaScript 8+ ...
📑 About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders wit ...
📑 Description :Responsibilities 1. Act as the senior technical authority in the team, specializing in backend development with TypeScript and Node.js, while also possessing a solid understanding of full-stack development principles.2. Work in close partnership with the Scrum ...
📑 Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to he ...
📑 Let’s be #BrilliantTogether ISS STOXX is actively hiring for a Senior Java Full Stack Developer to join ourteam in Mumbai (Goregaon East), India. Overview: As a Senior Java Full Stack Developer at ISS STOXX, you will play a key role in designing, implementing, and ...
📑 Company Overview Twixor is a Singapore-headquartered IT Services and IT Consulting company transforming customer engagements through intelligent business process automation over messaging channels. Serving a global client base, including Fortune 500 companies, Twixor delivers digital ...
📑 Description : Overview: The Java Full Stack Specialist evaluates learners’ technical proficiency in full-stack development, provides mentorship, and ensures alignment with industry standards. This role involves comprehensive assessment across Java, backend frameworks, front ...
📑 Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) About Fold Health Fold Health is building a ...
📑 Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides expertise in one or more ...
📑 Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...
📑 We are looking for an experienced Senior Full Stack Developer who can handle both front-end and back-end development, contribute to API integrations, and mentor junior developers. This is a fully remote position. Job Responsibilities Build and maintain scalable web applic ...
📑 Job description We are seeking a talented Senior Full Stack Engineer (Backend) to develop backend solutions using TypeScript and JavaScript, contributing to our AI Factory products. The role involves working alongside cross-functional teams to develop robust backend services that suppo ...
📑 Job Description – Full Stack Lead Engineer (C#) Location: Hyderabad Work Module: Work From Office Experience: 8+ Years Employment Type: Full-Time Company Overview At Codvo, software and peo ...
📑 We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description: Responsibilities: Front-End Development Excellence: </p ...
📑 Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...
📑 We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description: Responsibilities: Front-End Development Excellence: </p ...
📑 Raven is a YC-backed startup (S22) building AI assistants for manufacturing plants. We're taking decades of manufacturing expertise and combining it with AI to solve real operational problems. Backed by top VCs, we're a small, focused team working to make industrial operations safer, smarter, and more efficie ...
📑 Candidate should be able to: Design and develop microservices using node.js. Participate in agile development processes in SDLC, including sprint planning, iterative development, estimations, and design sessions Communicate effectively across desks, teams, and departments Develop clean, mo ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,404+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Senior Developer - ReactJS Full stack | ALIQAN Technologies | Full-time |
| Senior Software Engineer - Full Stack | Solifi | Full-time |
| Beacon.li- Senior Full Stack Engineer | Nexthire | Full-time |
| Atlassian Full-Stack Forge Developer | SolarEdge | Full-time |
| Software Engineer - Full Stack Java | 5100 Kyndryl Solutions Private Limited | Full-time |
| Java Full Stack(Angular) Developer | Gainwell Technologies | Full-time |
| Senior Full Stack Developer -MERN | Colan Infotech Private Limited | Full-time |
| Principal - Full Stack UI Developer | Netskope | Full-time |
| ShimentoX Technologies - Full Stack Developer | Nexthire | Full-time |
| Full stack Developer - Java/Vue | Mercedes-Benz | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!