📑 Job DescriptionWe are seeking a talented Senior Full Stack Engineer (Backend) to develop backend solutions using TypeScript and JavaScript, contributing to our AI Factory products. The role involves working alongside cross-functional teams to develop robust backend services that suppo ...
📑 At Marketplace, our mission is to help readers turn their aspirations into reality. We arm people with trusted advice and guidance, so they can make informed decisions they feel confident in and get back to doing the things they care about most.We are a ...
📑 Job DescriptionHiring: Application Developer – Python Full Stack (Open Source + Azure)Location: Bangalore (Onsite) Experience: 8–10+ Years (Mandatory 8+ years Python Full Stack ...
📑 Role: Java with AngularSkill set: Java, Angular, Spring Boot, AWS, MicroservicesExperience: 3 to 9 Years Role DescriptionDesign, develop, and maintain Java-based applications using Spring Boot and Angular.Build and integrate REST APIs ...
📑 Job SummaryThe Power Platform Developer will be responsible for designing, developing, and deploying business applications using Microsoft Power Apps, Power Automate, and Power BI. The role involves building Canvas and Model-Driven apps, automating business workflows, integr ...
📑 Job SummarySynechron is seeking a skilled Full Stack Developer with extensive experience in Node.js and React.js to support the development of scalable, high-performance enterprise applications. This role involves designing, developing, and maintaining robust front-end and back-end systems, integr ...
📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
📑 Full-Stack Developer Internship Location: Bengaluru Employment Type: Internship (3-6 months) Experience Level: Entry-Level/Recent Graduate <sp ...
📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
📑 Location: Bangalore out ring road, 3 days mandatory work from office at client locationExperience Range 6 - 10 YearsJob Type: 6 months contract + ext Need Immediate joiners only Jo ...
📑 We are seeking a Full Stack Software Engineer with strong expertise in Node.js, React.js, and Generative AI integrations. You will be responsible for building scalable digital products and embedding AI-driven capabilities into applications.<stron ...
📑 Company: PrimeSoft Role : Senior Software Engineer (.NET + Angular Full stack) Responsibilities: Participate in the design and development of tools and technologies for integrating, proce ...
📑 Responsible for collaborating with advisors to define solution designs, developing scalable and high-performing code, ensuring code quality and security, leading code reviews, managing priorities, facilitating cross-team communication, acting as a demo content owner, mentoring junior developers, and supportin ...
📑 Tech Lead – Full Stack Developer Position Tech Lead – Full Stack Developer Position We are excited to offer a career opportunity for a dynamic Tech Lead – Full Stack Developer based in Hyderabad. This role is tailored for professionals with 4-6 years of experience in full stack deve ...
📑 ZoomInfo is where careers accelerate. We move fast, think boldly, and empower you to do the best work of your life. You’ll be surrounded by teammates who care deeply, challenge each other, and celebrate wins. With tools that amplify your impact and a culture that backs your ambition, you won’t just contribute ...
📑 Senior Full Stack Developer - Sitecore We are looking for a Senior Full S ...
📑 Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
📑 Power the Future with us!At SolarEdge (NASDAQ: SEDG), we’re a global leader in smart energy technology, with over 3,000 employees, offices in 34 countries, and millions of installations worldwide. Our innovative solutions include solar inverters, ba ...
📑 Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
📑 Summary:GHX is looking for a Software Engineer with UI/frontend as well as backend and/or analytics experience. You should be able to demonstrate excellent problem-solving skills, self-motivated, highly detail oriented, able to context switch easily while working on multiple projects.You ...
📑 Responsibilities:1. Develop front end website architecture using Angular JS, ReactJS, and HTML/CSS2. Design and develop backend services using Spring Boot3. Integrate user-facing elements with server-side logic using Rest APIs4. Create and maintain technical documentation5. Troubleshoot ...
📑 Tätigkeitsbereich:IT/TelekommunikationFachabteilung:SW Release Management-1Gesellschaft:Mercedes-Benz Research and Development India Private LimitedStandort:Mercedes-Benz Research and Development India Private Limited, BangaloreStartdatum:sofortVeröffentlichungsdatum:..6Stellennummer:MER3YMQArbeitszeit:Vollzeit ...
📑 JOB DESCRIPTION Job TitleSoftware Technologist - Java Full StackJob DescriptionJava Full Stack DeveloperPhilips is a global leader in health technology, dedicated to improving lives through meaningful innovation. One of our five core businesses, Conne ...
📑 Requirement Detail Job SummaryWe are looking for a highly skilled and experienced Senior Java Developer with strong expertise in enterprise application development using Java 17, Spring Boot, SQL, REST APIs, and Messaging Services such as Kafka or JMS. The ideal c ...
📑 This role is for one of the Weekday's clientsSalary range: Rs 1200000 - Rs 1600000 (ie INR 12-16 LPA)Min Experience: 7 yearsLocation: Pune, Bengaluru, Chennai, CoimbatoreJobType: full-timeWe are seeking a skilled Java Full Stac ...
📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
📑 About Algotale At Algotale, we believe in the transformative potential of data to reshape industries, drive innovation, and create unparalleled value. Established in 2020 by a team of passionate and visionary professionals, Algotale set out to red ...
📑 Company Overview: Schneider Electric is a global leader in energy management and automation, committed to providing innovative solutions that ensure Life Is On everywhere, for everyone, and at every moment.We are expanding our team in Gurugram and looking for a full stack developer to enhance our cloud capab ...
📑 We are looking for a Staff Software Engineer who will design and build scalable full-stack software systems that deliver measurable business value.You will work directly with teams across Commercial, Manufacturing, and R&D to discover problems, navigate ambiguity, ...
📑 Job description:5-15 years Backend/Full Stack Developer with hands-on experience in Python (FastAPI) for backend development and Next.js for frontend development. Primary skill must be backend.The ideal candidate should be comfortable working across the full stack, build ...
📑 Join Postman as an AI Builder : Are you excited about AI’s potential? Do you want to work toward the goal of using AI to help millions of developers be more effective at their jobs? At Postman, one of our goals is to create net new developers in the world, and we believe products li ...
📑 Join our high-performing team as a Senior Full Stack GraphQL Developer. You'll build next-generation web applications using GraphQL, React.js, NEST.js, Express.js, and Azure Cloud. In this role, you'll develop scalable, robust solutions and drive exceptional, user-centric experiences in a collaborative, fast-pac ...
📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
📑 Job DescriptionSenior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. R ...
📑 Job Description:TITAN COMPANY LTD Position Technical Consultant – Full Stack Developement Job Location Bangalore Level L5 Reporting to Senior Manager – IT Roles and Responsibilities ...
📑 Description Genpact (NYSE: G) is an agentic and advanced technology solutions company. We leverage process intelligence and artificial intelligence to deliver measurable outcomes. With a strong partner ecosystem and decades of client trust, we provide innovative solutions that transform how ...
📑 Job DescriptionFull-Stack ...
📑 Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
📑 We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description:Responsibilities:Front-End Development Excellence:L ...
📑 Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utilizing ...
📑 ZoomInfo is where careers accelerate. We move fast, think boldly, and empower you to do the best work of your life. You’ll be surrounded by teammates who care deeply, challenge each other, and celebrate wins. With tools that amplify your impact and a culture that backs your ambition, you won’t just contribute ...
📑 About the companyLexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success.Lexitas offers an array of services including local and national c ...
📑 Lov.Cash is a mobile financial services platform aimed at consumers and businesses in emerging markets. We are developing innovative, accessible & affordable financial services solutions such as mobile wallets & payment terminals (POS) for sending and receiving digital currency. Lov.Cash provides an alternative ...
📑 Associate Software Engineer - Full StackCompany:Boeing India Private LimitedOverview As a leading global aerospace company, Boeing develops, manufactures and services commercial airplanes, defense products and space systems for customers in more than 150 countries. As a top U.S. ex ...
📑 About the client: One of the largest non-bank mortgage service providers and a leading mortgage lender in India. Role: Java Full stack Senior Developer Mode: Work from office 5 days - Chennai Experience: 2-5 Years</ ...
📑 JD for Full-Stack / Back-End Developer Go Language About the Role We are looking for an experienced Go (Golang) Developer with 7 10 years of experience, capable of contributing either as a strong back-end engineer or as a full stack developer. The ideal candidate should have deep hands-on e ...
📑 Job DescriptionThe Staff Web Engineer – Full Stack (Frontend Heavy) will play a key role in building scalable, consumer-facing web applications within the Marketplace domain in Experian Consumer Services. This role focuses on strong frontend development while having a good understanding o ...
📑 Job description We are looking for a skilled Senior Software Engineer to play a key role in our front-end development using ReactJS. This role involves enhancing user interface components and implementing well-conceived designs into our AI-powered SaaS solutions. You will collaborate with ...
📑 Job TitleSoftware Engineering & Development - Java Full Stack, OfficerRole Summary & Role DescriptionJava Full Stack Developer will contribute to the development, enhancement and maintenance of financial applications as a member of an agile scrum team. This is an oppo ...
📑 Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,541,027+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Senior Full Stack Engineer (Backend) | Sia | full-time |
| Senior Staff Engineer - Full Stack | Corvi Technologies | Full-time |
| Application Developer – Python Full Stack | Vrinda International | Full-time |
| Java Full stack Developer (Angular) | Colan Infotech Private Limited | Full time |
| Full Stack Developer - Power Platform | ECS | Enterprise Change Specialists | FULL TIME |
| Full-Stack Developer (Node.js & React.js) | Synechron | Full time |
| Software Engineer - Full Stack Development | Kyndryl | Full-time |
| Full-Stack Developer Internship - Unpaid | Acowale | Full-time |
| Software Engineer - Full Stack Development | Kyndryl | Full-time |
| Senior Developer - ReactJS Full stack | ALIQAN Technologies | Contract, Other |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!