📑 Innovation is and will always be the core of SAP Fioneer, and it is the promise of why we were spun out of SAP:Agility, innovation, and Delivery.SAP Fioneer builds on a heritage of outstanding technology and a deep understanding of corporate and consumer demands. At the heart of it all it is simple: We ...
📑 Candidate should be able to: Design and develop microservices using node.js. Participate in agile development processes in SDLC, including sprint planning, iterative development, estimations, and design sessions Communicate effectively across desks, teams, and departments Develop clean, mo ...
📑 Job DescriptionWe are seeking a Full Stack Developer to build a configurable, UI-driven self-service platform for contact center operations on top of Amazon Connect. The platform enables business users to manage call routing, queues, and outbound campaigns without requiring code changes or developer ...
📑 Date Posted:2026-06-10Country:IndiaLocation:IN-KA-BENGALURU-NORTHGATE ~ Sy No 2/2 Venkatala Village ~ SY NO 2/2 VENKATALA VILLAGE, Yelahanka HobliPosition Role Type:OnsiteAt RTX, the world largest aerospace and defense company, 185,000 great minds are un ...
📑 Requirement Detail Job Summary We are looking for a highly skilled and experienced Senior Java Developer with strong expertise in enterprise application development using Java 17, Spring Boot, SQL, REST APIs, and Messaging Services such as Kafka or JMS. The ideal cand ...
📑 Join our high-performing team as a Senior Full Stack GraphQL Developer. You'll build next-generation web applications using GraphQL, React.js, NEST.js, Express.js, and Azure Cloud. In this role, you'll develop scalable, robust solutions and drive exceptional, user-centric experiences in a collaborative, fast-pac ...
📑 Location: Hyderabad, IndiaExperience Required: 6+ Years (Overall SDLC) | 4+ Years (SFCC)Notice Period: Immediate to 15 Days Preferred Technical Stack & Key Responsibilities💻 Frontend E ...
📑 Job description We are seeking a talented Senior Full Stack Engineer (Backend) to develop backend solutions using TypeScript and JavaScript, contributing to our AI Factory products. The role involves working alongside cross-functional teams to develop robust backend services that support ...
📑 JOB DESCRIPTION: Senior Full Stack Developer (AI-Integrated Applications).WHO WE ARE:At eigital, we drive progress by enabling global organisations to stay ahead in an ever-changing technological, societal, and cultural landscape ...
📑 The Applications Development Intermediate Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute ...
📑 Responsibilities:• Translate application storyboards and use cases into functional applications • Design, build, and maintain efficient, reusable, and reliable code • Integrate data storage solutions may include databases, key-value stores, blob stores, etc. • Familiar with API Develo ...
📑 Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to hel ...
📑 About NetskopeToday, there's more data and users outside the enterprise than inside, causing the network perimeter as we know it to dissolve. We realized a new perimeter was needed, one that is built in the cloud and follows and protects data wherever it goes, so we started Netskop ...
📑 The Applications Development Intermediate Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute ...
📑 Job Description<span class=highlight style=background-color ...
📑 Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) ______________ About Fold Health ...
📑 Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utilizing ...
📑 Job Description The primary goal of this role is to utilize advanced software engineering skills to oversee the entire lifecycle of our software products and services—from planning and design to deployment, support, and maintenance. This role requires the ability to independently manage i ...
📑 You'll be part of global teams across Bupa marketsYou'll get to work on building innovative digital health solutionsAbout Our ClientBupa is a leading international healthcare company, established in 1947.Job DescriptionLead the development an ...
📑 Job Title: Principal Full Stack AI EngineerJob Location: WFH/Remote / Preference Gurugram Reporting By: Team of Developers Experience: 8+ years8+ years of work experience wi ...
📑 Job Description We are seeking a highly skilled Sr. Full-Stack Developer to design, develop, and maintain web-based applications leveraging modern frameworks and cloud infrastructure. The ideal candidate will work on both front-end and back-end development tasks, ensuring seamless inte ...
📑 Job Description – Product/Fullstack Lead ( SaaS | Architecture & Delivery Focused) +if they have also used AI in their projects Location: Hyderabad- In office (no remote) Experience Level: 6–15 years ...
📑 The purpose of this role is to develop required software features, achieving timely delivery in compliance with the performance and quality standards of the company.Job Description:Responsibilities:Develop and implement custom workflows for creative production and automation using ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work wi ...
📑 Job Description You understand the entire stack from web/mobile client to back-end databases and networking systems and are capable of building mission critical application features using industry standard engineering best practices. You have experience working with large scale applications on cloud. Work as a t ...
📑 About the Company Vagaro is a global leader in cloud-based business management software, serving the salon, spa, beauty, fitness, and wellness industries. Our platform enables businesses to manage scheduling, payments, marketing, and operations fro ...
📑 Position: Python Fullstack Developer Exp: 7-10 Years [Minimum 5 yrs must be in Python] Location: Hyderabad Working Mode: WFO ...
📑 Job DescriptionWe’re Hiring: Full Stack Lead (Python + React | AI-Driven Development) Location: Hyderabad Job Type: Full-Time Experience: 6+ YearsWe are looking for an experienced ...
📑 Position Description: Company Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and bu ...
📑 HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...
📑 Job DescriptionWe are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have h ...
📑 <p style="margin-bottom:11px"><span style="font-size:12pt"><span style="line-height:115%"><span style="font-family:Calibri,sans-serif"><span style="font-size:14.0pt"><span style="line-height:115%">Python + Re ...
📑 Hiring: Application Developer – Python Full Stack (Open Source + Azure)Location: Bangalore (Onsite) Experience: 8–10+ Years (Mandatory 8+ years Python Full Stack)Budget: Up to ₹21 LPAW ...
📑 Job DescriptionFull-Stack ...
📑 Job DescriptionWe are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have h ...
📑 Senior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. Role: Senior Architect (Ful ...
📑 .Full stack Lead -React Node - CREQ191191 Description Development and implementation of web applications using ReactJS, NodeJS (with NestJS or ExpressJS), and TypeScript/JavaScript. Design, optimize, and manage PostgreSQL databases, including schema design and data migration/transformation. Implement b ...
📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
📑 Job Description :We are hiring an engineer of Full Stack Development with a strong frontend and backend background in cross-platform software engineering and experience with delivering projects. This opportunity will support the transformation of our industry standard order and delive ...
📑 Responsibilities:1. Develop front end website architecture using Angular JS, ReactJS, and HTML/CSS2. Design and develop backend services using Spring Boot3. Integrate user-facing elements with server-side logic using Rest APIs4. Create and maintain technical documentation5. Troubleshoot ...
📑 Company: 8 Views Website: Position: Full Stack Developer Location: Hyderabad (Onsite) Work Hours: 9:30 AM – 6:30 PM (Monday to Friday)</p ...
📑 Technical Lead - Java Full Stack IT (Information Technology) Permanent contract Bangalore, India Hybrid Reference 250009IB Start date Immediately Publication date 2025/06/14 Responsibilities Profile RequiredResponsibilitiesResponsible for understandi ...
📑 About the Role We are seeking a highly skilled Senior Full Stack Developer who can design, develop, and deliver high-quality software solutions across the full technology stack.This role requires strong technical expertise, problem-solving skills, and the ability to work collaboratively with cross-f ...
📑 Our storyAt Alight, we believe a company’s success starts with its people. At our core, we Champion People, help our colleagues Grow with Purpose and true to our name we encourage colleagues to “Be Alight.”Our Values:Champion People – be empathetic and help create a p ...
📑 Candidate should be able to: Ensure quality by performing thorough testing and leveraging peer reviews for your work and the work of cross-functional teams Implement excellent end-user experiences, continually raising the bar on functionality, usability, and simplicity Drive robust, maintainable, ...
📑 About Company: It is a data and analytics company Experience: 3 to 8Years Location: Bangalore Title: Python Developer Notice Period: Immediate to 30 Days </p ...
📑 Job Description We are looking for a react native developer with 1-2 years of experience. Responsibilities.1. Develop and build mobile apps for iOS & Android devices using React Native Framework.2. Integrate Web API into mobile app code base.3. Manage 3rd Party API Integrations ...
📑 Job Title: Senior Software Developer [Full Stack] Location: Bengaluru About Company: Invoyz Financial Solutions Pvt. Ltd. is a Bengaluru based financial services technology start-up with a fo ...
📑 Description Position at DNEG Core Services is looking for a Full Stack Developer to join its Artist Tool project within its Data Services workstream.The Core Services group provides foundational technologies to other technology groups within DNEG. We are a team of software developers wh ...
📑 Full Stack Developer (Backend/.NET)Millennium is seeking a skilled Full Stack Developer (Backend/.NET) to build and support complex inbound and outbound integrations across corporate accounting, partnership accounting, and financial systems. The ideal candidate brings strong backend engineering expertise, wit ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,382+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Cloud Native Full Stack developer | SAP Fioneer | Full time |
| Senior Full Stack (node.js) Engine... | Anicalls (Pty) Ltd | Full Time/Permanent |
| Full Stack Developer (Outbound/Selfservice) | Miratech | full-time |
| Principal Specialist, Full Stack Development | Raytheon Technologies | Full time |
| Java Full Stack Developer (Senior) | Staffing Technologies | Full-time |
| Senior Full Stack Developer (GraphQL) | dentsu | Full-time |
| Full Stack Software enginner- SFCC | N Consulting Ltd | Full-time |
| Senior Full Stack Engineer (Backend) | Sia Partners | Full-time |
| Senior Full Stack Developer Superstar | eatOS POS Inc. | Fulltime |
| Full Stack Developer - Java Angular | 12542 Citicorp Services India Private Limited | Full time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!