📑 About Algotale At Algotale, we believe in the transformative potential of data to reshape industries, drive innovation, and create unparalleled value. Established in 2020 by a team of passionate and visionary professionals, Algotale set out to red ...
📑 The Full Stack Software Engineer, IAM Solutions, is responsible for designing, developing, and maintaining custom identity and access management solutions that support secure, scalable, and automated access across the organization. This role focuses on building and enhancing IAM capabilities such as identity ...
📑 Position Description: Company Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and busines ...
📑 Senior Software Engineer - Full stack Location: Noida, UP, IN BCR (Barco Control Rooms) The Barco Control Rooms business unit is making workflow and visualization solutions for the Control Room market since to help operators collect, visualize and share critica ...
📑 Full Stack Developer (8+ Years) | Lead Scalable Projects | 18-24 LPA Location: Surat / Remote Experience: 8+ years Type: Full-timeReady to Build & Lead Scalable, High-Impact Applications?We ...
📑 Job Title: Full Stack Developer (React + Node.js + AWS)Experience: 7–10 YearsLocation: Bangalore / PuneJob Summary:We are seeking an experienced Full Stack Developer with strong expertise in React.js, Node.js, and AWS to design, develop, and maintain scala ...
📑 Designation: Associate Product Architect Full Stack Developer Job Location: BangaloreExperience - 5+ YearsSkills - Python, React/ Angualr Essential Functions • Continuous delivery of high-quality code fo ...
📑 Senior Full-Stack EngineerAbout Us:We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the U ...
📑 JOB DESCRIPTION Job TitleSoftware Technologist - Full Stack C++Job DescriptionThe Software Development Engineer is responsible for Participation in full software development processes, working with broader autonomy and in pairing mode with other software team members, ...
📑 Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utilizing ...
📑 Position Overview We are seeking a Senior Full-Stack Software Engineer with a strong background in web and backend application development. The ideal candidate has a proven track record of delivering high-quality software, thrives in a collaborative team environment, takes ownership ...
📑 You may know McCormick as a leader in herbs, spices, seasonings, and condiments – and we’re only getting started. At McCormick, we’re always looking for new people to bring their unique flavor to our team.McCormick em ...
📑 Responsibilities:Deliver fully functional, well tested web application/middle ware/APIs developed according to quality standards.Analyze, Design, Implement and Integrate functional requirements in new/existing solutions.Working closely with analysts, designe ...
📑 Company: Zucol Group Address-18th Floor, AIPL Business Club, Sector 62, Gurugram – 122102Employment Type: Full-Time (On-site) Work Mode- 5 Days onsite <p ...
📑 Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business. With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...
📑 • Analysis, design, and implementation of business requirements utilizing Hybris technologies and spring methodology in Java EE • Experience developing high volume/transaction J2EE applications: OO/AD, Java, Servlets, JSP Spring, SoapUI, Junit/Testing • Experience with Model-View-Controller (MVC) frame ...
📑 Job DescriptionSenior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. R ...
📑 Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides expertise in one or more ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 Job Description: SDE3 / Principal Engineer Location: On-Site Hyderabad About the Role:We are seeking a highly skilled SDE3 / Principal Engineer to join our dynamic engineering team. This is not a r ...
📑 Sr. Full Stack Developer<br / ...
📑 We are seeking a highly skilled Sr. Full-Stack Developer to design, develop, and maintain web-based applications leveraging modern frameworks and cloud infrastructure. The ideal candidate will work on both front-end and back-end development tasks, ensuring seamless integration, performance optimization, and s ...
📑 Job DescriptionHiring: Application Developer – Python Full Stack (Open Source + Azure)Location: Bangalore (Onsite) Experience: 8–10+ Years (Mandatory 8+ years Python Full Stack ...
📑 Full Stack Developer Job Location: Hyderabad Work Mode: 5 days Onsite Java, Spring Boot, Angular or ReactJS, AWS or Azure Cloud, ...
📑 Some careers shine brighter than others.If you’re looking for a career that will help you stand out, join HSBC and fulfil your potential. Whether you want a career that could take you to the top, or simply take you in an exciting new direction, HSBC offers opportunities, support and rewards that will t ...
📑 Job Description Description The hiring manager would like the consultants co-located together in same city / building to support each other. ** The keys to this requirement are backend Java, Spring Boot (Spring IO , Spring MVC), Google ...
📑 TeamViewer provides a leading Digital Workplace platform that connects people with technology—enabling, improving and automating digital processes to make work work better. Our software solutions harness the power of AI and shape the future of digitalization.We believe that our diverse teams and strong ...
📑 We’re Hiring: Full Stack Lead (Python + React | AI-Driven Development) Location: Hyderabad Job Type: Full-Time Experience: 6+ YearsWe are looking for an experienced Full Stack Lead wh ...
📑 Company SummaryFirst American (India) is a GCC (Global Capability Center) of the First American Financial Corporation (NYSE: FAF) family of companies. FAI is a proud member of the FORTUNE 500 companies and has been amongst the Fortune 100 Best Companies to Work For® list for eight consecut ...
📑 Job DescriptionIgnite Your Future: Are you an experienced Senior Full-Stack Engineer ready to independently drive solutions, resolve complex technical challenges, and contribute significantly to the future of intelligent manufacturing? Join QAD, where we are redefinin ...
📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
📑 At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. Career Family - DE TechOpsRole Ty ...
📑 Job Description: Engineer-Methods & Tools About the team:Methods and Tools (M&T) is a transverse team working with different core engineering verticals in Airbus. The USP of this team is working in a multi-f ...
📑 Role: Full Stack Developer Location-Bangalore Exp-5-10 yearsTo Apply:<a href= ...
📑 Job Description – Product/Fullstack Lead ( SaaS | Architecture & Delivery Focused) +if they have also used AI in their projects Location: Hyderabad- In office (no remote) Experience Level: 6–15 years ...
📑 About the Role We are seeking a highly skilled Senior Full Stack Developer who can design, develop, and deliver high‑quality software solutions across the full technology stack. This role requires strong technical expertise, problem-solving skills, and the ability to work collaboratively with cross-functional te ...
📑 The Applications Development Intermediate Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute ...
📑 Job Description<span class=highlight style=background-color ...
📑 Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) ______________ About Fold Health ...
📑 Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utilizing ...
📑 Responsibilities:• Translate application storyboards and use cases into functional applications • Design, build, and maintain efficient, reusable, and reliable code • Integrate data storage solutions may include databases, key-value stores, blob stores, etc. • Familiar with API Develo ...
📑 {railsEnv:production,inMailer:false,i18nLocale:en,i18nDefaultLocale:en,rorVersion:13.0.2,rorPro:false,href: ...
📑 Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
📑 We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description:Responsibilities:Front-End Development Excellence:L ...
📑 Requirement Details are below:Title: Senior Full Stack Developer Banking DomainLocation: Thousand Lights, ChennaiWork Mode: Onsite (5 Days) | Sat/Sun Week OffDepartment: Software DevelopmentPositions: 1Employment Type: Full TimeRemote: NoNot ...
📑 Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business.With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...
📑 Role: Java with AngularSkill set: Java, Angular, Spring Boot, AWS, MicroservicesExperience: 3 to 9 Years Role DescriptionDesign, develop, and maintain Java-based applications using Spring Boot and Angular.Build and integrate REST APIs ...
📑 Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
📑 Company Overview: Schneider Electric is a global leader in energy management and automation, committed to providing innovative solutions that ensure Life Is On everywhere, for everyone, and at every moment. We are expanding our team in Gurugram and looking for a full stack developer to enhance our cloud capa ...
📑 Job Description Position Overview Version1 is seeking full stack developers with highly skilled in front-end development skills in Angular, HTML, CSS, JavaScript and Typescript and strong backend development skills in Java, Springboot Micro Services and NodeJS. The ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,428+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Algotale - Lumiq (Full stack engineer) | Nexthire | Full Time |
| Full Stack Engineer- IAM Solutions | AHEAD | Full Time |
| Technical Lead - Java Full Stack | CGI | Full Time |
| Senior Software Engineer - Full stack | Barco | Full-time |
| Full Stack Developer (8+ Years) | Refining Skills Academy | Full time |
| Node + React Full Stack Developer | Synechron | Full time |
| Quation - Full Stack Web Developer | Nexthire | Full Time |
| Full-Stack Engineer - System Architecture | Lytegen | Full time |
| Software Technologist - Full Stack C++ | Philips | Full time |
| Senior Java Full Stack Developer | Epam | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!