1,069,315+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Head of AI Search & Organic Growth

📑 About the job Head of AI Search & Organic Growth Location: Gurgaon About PlanetSpark PlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Ai engineering manager

📑 AARC Group is focused on building multi-agent, agentic AI systems for real, business-critical work. We design AI agents that plan, reason, and act, orchestrating multi-step workflows end to end, calling tools and APIs, retrieving and reasoning over documents, and returning trustworthy, structured outputs. Combin ...

Ai engineering manager

📑 AARC Group is focused on building multi-agent, agentic AI systems for real, business-critical work. We design AI agents that plan, reason, and act, orchestrating multi-step workflows end to end, calling tools and APIs, retrieving and reasoning over documents, and returning trustworthy, structured outputs. Combin ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: </stro ...

Technical Lead Data

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don‘t just move data, we oper ...

Head of AI Search & Organic Growth

📑 About the job Head of AI Search & Organic Growth Location: Gurgaon About PlanetSpark PlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents acro ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: </stro ...

Java Fullstack Engineer

📑 Job DescriptionSenior Software Engineer – Java TrackEurofins IT Solutions, Bengaluru, Karnataka, India With facilities in Europe, the United States, and Asia, Eurofins Genomics is an internationally leading provider of DNA sequencing services, genotyping services, DNA s ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: </stro ...

Technical Lead Data Engineering

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don't just move data, we operati ...

Technical Lead Data Engineering

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don't just move data, we operati ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: </stro ...

Head of AI Search & Organic Growth

📑 About the job Head of AI Search & Organic Growth Location: Gurgaon About PlanetSpark PlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Head of AI Search & Organic Growth

📑 About the job Head of AI Search & Organic Growth Location: Gurgaon About PlanetSpark PlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Technical Lead Data Engineering

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don't just move data, we operati ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: </stro ...

Senior Java Developer

📑 Job DescriptionSenior Software Engineer – Java TrackEurofins IT Solutions, Bengaluru, Karnataka, India With facilities in Europe, the United States, and Asia, Eurofins Genomics is an internationally leading provider of DNA sequencing services, genotyping services, DNA s ...

Senior Java Developer

📑 Job DescriptionSenior Software Engineer – Java TrackEurofins IT Solutions, Bengaluru, Karnataka, India With facilities in Europe, the United States, and Asia, Eurofins Genomics is an internationally leading provider of DNA sequencing services, genotyping services, DNA sy ...

Sr Java Fullstack Developer

📑 Job DescriptionSenior Software Engineer – Java TrackEurofins IT Solutions, Bengaluru, Karnataka, India With facilities in Europe, the United States, and Asia, Eurofins Genomics is an internationally leading provider of DNA sequencing services, genotyping services, DNA s ...

Partner Markets National CBS MKT Global Markets/Client Service New Delhi

📑 The opportunity : Partner-National-Markets-CBS - MKT - Global Markets/Client Service - New DelhiNational : National comprises of sector agnostic teams working across industries for a well rounded experience.CBS - MKT - Global Markets/Client Service : </b ...

India Software Engineer

📑 About Inchcape Shipping ServicesAt Inchcape, our vision is to have a connected world, in which our customers trade successfully and make better decisions in every port, everywhere. We use technology and our global network to help our partners connect to a smoother, smarter ocean. Inchc ...

Java Fullstack Engineer

📑 Job DescriptionSenior Software Engineer – Java TrackEurofins IT Solutions, Bengaluru, Karnataka, India With facilities in Europe, the United States, and Asia, Eurofins Genomics is an internationally leading provider of DNA sequencing services, genotyping services, DNA sy ...

Staff Software Engineer (8 12 years)

📑 Job DescriptionIgnite Your Future: Are you an experienced Full-Stack Engineer ready to independently drive solutions, resolve complex technical challenges, and contribute significantly to the future of intelligent manufacturing? Join QAD, where ...

Senior Staff Software Engineer (12+ years)

📑 Job DescriptionIgnite Your Future: Are you an experienced Full-Stack Engineer ready to independently drive solutions, resolve complex technical challenges, and contribute significantly to the future of intelligent manufacturing? Join QAD, where ...

Lead Software Engineer (5 to 8 years)

📑 Job DescriptionIgnite Your Future: Are you an experienced Full-Stack Engineer ready to independently drive solutions, resolve complex technical challenges, and contribute significantly to the future of intelligent manufacturing? Join QAD, where ...

Vice President, Digital Product Analytics & Insights Enablement

📑 Our PurposeMastercard powers economies and empowers people in 200+ countries and territories worldwide. Together with our customers, we’re helping build a sustainable economy where everyone can prosper. We support a wide range of digital payments choices, making transactions secure, simple, s ...

MARTECH HEAD

📑 MarTech Head; Full-Time, Global Mandate Reports to: CP Gurnani, CEO Location: Gurugram / Singapore (Travel encouraged) Experience: 14–20 years The Company AionOS is an AI Operating System for Enterprise, headquartered in Singapore. Founded in April 2024 as a joint venture between InterGlobe Enterprises — the par ...

Staff Software Engineer (8 12 years)

📑 Job DescriptionIgnite Your Future: Are you an experienced Full-Stack Engineer ready to independently drive solutions, resolve complex technical challenges, and contribute significantly to the future of intelligent manufacturing? Join QAD, where we are rede ...

Ai engineering manager

📑 AARC Group is focused on building multi-agent, agentic AI systems for real, business-critical work. We design AI agents that plan, reason, and act, orchestrating multi-step workflows end to end, calling tools and APIs, retrieving and reasoning over documents, and returning trustworthy, structured outputs. Com ...

Technical Lead Data Engineering

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don't just move data, we operationalize th ...

Technical Lead Data Engineering

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don't just move data, we operationalize th ...

Java Fullstack Engineer

📑 Job DescriptionSenior Software Engineer – Java TrackEurofins IT Solutions, Bengaluru, Karnataka, India With facilities in Europe, the United States, and Asia, Eurofins Genomics is an internationally leading provider of DNA sequencing services, genotyping services, DNA synthesis products, and ...

Sr Software Engineer

📑 13-May-2026 Senior Software Engineer India (Remote) 10955BR Company Summary As the recognized global standard for project-based businesses, Deltek delivers software and information solutions to help organizations achieve their purpose. Our market leader ...

Mechanical design engineer – defence robotics (robotic arms & pan tilt systems)

📑 Work experience: 2-3 yearsLocation: Hyderabad (Balanagar area)Job type: Full-time, Permanent, On-siteDomain: Defence – Robotics, Autonomous Systems, Io T Systems, Fire Control Systems, and Training SimulatorsMandatory Requirement:This role is strictly focused on end-to-end mechanical design o ...

Mechanical design engineer – defence robotics (robotic arms & pan tilt systems)

📑 Work experience: 2-3 years Location: Hyderabad (Balanagar area) Job type: Full-time, Permanent, On-site Domain: Defence – Robotics, Autonomous Systems, Io T Systems, Fire Control Systems, and Training Simulators Mandatory Requirement: This role is strictly focused ...

Ai engineering manager

📑 AARC Group is focused on building multi-agent, agentic AI systems for real, business-critical work. We design AI agents that plan, reason, and act, orchestrating multi-step workflows end to end, calling tools and APIs, retrieving and reasoning over documents, and returning trustworthy, structured outputs. Com ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: Head of Product Location: Guru ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: Head of Product Location: Guru ...

Technical Lead Data Engineering

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don't just move data, we operati ...

Sr Java Fullstack Developer

📑 Job DescriptionSenior Software Engineer – Java TrackEurofins IT Solutions, Bengaluru, Karnataka, India With facilities in Europe, the United States, and Asia, Eurofins Genomics is an internationally leading provider of DNA sequencing services, genotyping services, DNA sy ...

Software Engineer (.net + Angular)

📑 Job DescriptionAbout EurofinsEurofins Scientific is an international life sciences company, providing a unique range of analytical testing services to clients across multiple industries, to make life and our environment safer, healthier and more sustainable. From the food you eat, ...

Windows Server Operator (Systems & Infrastructure)

📑 We are seeking an experienced L2 Lab Server Operator to manage, maintain, and optimizeour non-production, R&D, and testing laboratory environments. In this role, you will be thebackbone of our lab infrastructure, ensuring high availability, performance, and security across adiverse technical stack.<b ...

Senior Java Backend Engineer (Cloud & Distributes Systems)

📑 We are looking for a visionary Senior Java Developer to spearhead the development of high-throughput, cloud-native backend systems. In this role, you will go beyond simple coding to architect resilient microservices, design event-driven data pipelines using Kafka, and implement advanced caching strategies to ens ...

Senior Java Backend Engineer (Cloud & Distributes Systems)

📑 We are looking for a visionary Senior Java Developer to spearhead the development of high-throughput, cloud-native backend systems. In this role, you will go beyond simple coding to architect resilient microservices, design event-driven data pipelines using Kafka, and implement advanced caching strategies to ens ...

Senior Java Backend Engineer (Cloud & Distributes Systems)

📑 We are looking for a visionary Senior Java Developer to spearhead the development of high-throughput, cloud-native backend systems. In this role, you will go beyond simple coding to architect resilient microservices, design event-driven data pipelines using Kafka, and implement advanced caching strategies to ens ...

Senior Java Backend Engineer (Cloud & Distributes Systems)

📑 We are looking for a visionary Senior Java Developer to spearhead the development of high-throughput, cloud-native backend systems. In this role, you will go beyond simple coding to architect resilient microservices, design event-driven data pipelines using Kafka, and implement advanced caching strategies to ens ...

Senior AI Engineer

📑 Title:Senior AI Engineer — Inference & Agent SystemsLocation:- BLR/Remote IndiaWhat We're BuildingArcana is building AI agents that synthesize information across heterogeneous sources and deliver structured, reasoned answers in real time. The product only works if the agents ...

Senior Java Backend Engineer (Cloud & Distributes Systems)

📑 We are looking for a visionary Senior Java Developer to spearhead the development of high-throughput, cloud-native backend systems. In this role, you will go beyond simple coding to architect resilient microservices, design event-driven data pipelines using Kafka, and implement advanced caching strategies to ens ...

Windows Server Operator (Systems & Infrastructure)

📑 We are seeking an experienced L2 Lab Server Operator to manage, maintain, and optimizeour non-production, R&D, and testing laboratory environments. In this role, you will be thebackbone of our lab infrastructure, ensuring high availability, performance, and security across adiverse technical stack.<b ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,069,315+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Head of AI Search & Organic Growth PlanetSpark Full-time
Ai engineering manager AARC Environmental Full-time
Ai engineering manager AARC Environmental Full-time
Forward Deployed Product Specialist... Spyne Full-time
Technical Lead Data EvoluteIQ Full-time
Head of AI Search & Organic Growth PlanetSpark Full-time
Forward Deployed Product Specialist... Spyne Full-time
Java Fullstack Engineer Eurofins Contract
Forward Deployed Product Specialist... Spyne Full-time
Technical Lead - Data Engineering EvoluteIQ Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!