📑 Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.js, and crafting responsive frontends with Flutter and React.js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store ...
📑 Company- ShimentoX TechnologiesPosition- Java DeveloperYOE- 5+ yearsLocation- BangaloreWork Mode- Onsite Job Description: We are seeking an experienced Full Stack Developer with strong expertise ...
📑 Job Title : MLOps Engineer (6+ Years Experience)Location : Gurgaon ( 5 Days - Wfo )Employment Type: Full-timeExperience Level: Senior (6+ years) We are seeking a seasoned MLOps Engineer with 6+ years of hands-on experienc ...
📑 Primary Skills: Altium-Intermediate, Cadence Allegro-Expert, AutoCAD-Intermediate, PCB Design-Expert, Electrical Engineering-IntermediateContract Type: Full time opportunityLocation: Pune Note: - This is a diversity Position. Only Female candidates needed Job Summary: We ar ...
📑 About Evernorth: Evernorth Health Services, a division of The Cigna Group (NYSE: CI), creates pharmacy, care, and benefits solutions to improve health and increase vitality. We relentlessly innovate to make the prediction, prevention, and treatment of illness and disease more accessib ...
📑 Job Title: Java Backend Developer (AWS Cloud) Experience: 5+ Years Location: Hyderabad Work Mode: WFO (5 Days) Job Summary: We are seeking a talented Java Developer with expe ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you become better every day. We know what it takes to lead UPS into tomorrow—people with a unique combination of skill + passion. ...
📑 Description :Job Profile: Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based software application. To Analyse domain specific technical or low level requirement and modificatio ...
📑 Develop full‑stack features using Java, Spring Boot, REST APIs, and modern JavaScript frameworks. Build cloud‑native applications and services on AWS (Lambda, S3, SNS/SQS, DynamoDB/RDS, CloudWatch). Implement CI/CD pipelines, automated testing, and deployment workflows. Support production systems, troubleshoo ...
📑 Role Overview: We are seeking a dynamic Director – Product Innovation & Engineering to lead our GenAI Products and Accelerator strategy within the Studio team. This role combines deep hands-on expertise in developing full stack solutions using GenAI, leading en ...
📑 Job Description: ServiceNow Portal Developer Location: Hyderabad (preferred), BangaloreExperience: 5+ yearsSkills: ServiceNow, Portal Development Role Overview: We ar ...
📑 Job Summary: Artic Consulting is seeking a talented Mid-Level Microsoft Application Developer with over 5+ years of experience to join our team. The ideal candidate will be proficient in Microsoft technologies and passionate about developing high-quality, scalable applications. Key Responsibilities ...
📑 Job Description: ServiceNow Portal Developer Location: Hyderabad (preferred), BangaloreExperience: 5+ yearsSkills: ServiceNow, Portal Development Role Overview: We ar ...
📑 Wednesday Solutions Position: AI Engineer Location: Pune, Maharashtra Core Responsibilities Architect: Choose the right tools, framewor ...
📑 Role: Software Developer Skills : Software Developer- Ruby on Rails, Elixir, React, MVC Location : Hyderabad (hybrid twice a week work from office) < ...
📑 Description :Job Profile: Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based software application. To Analyse domain specific technical or low level requirement and modificatio ...
📑 Role Summary Builds and maintains robust backend systems with a strong focus on microservices, REST API design, and secure, scalable data processing. Contributes to IoT and time‑series data solutions, Azure‑native development, and performance optimization while actively participating ...
📑 Salesforce Tech Lead Location: @Hyderbad & Chennai Fulltime opportunity Salesforce Tech Lead and Developer with more than ten years of experienc e.Independently build and unit test components and ...
📑 Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.js, and crafting responsive frontends with Flutter and React.js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store ...
📑 This isn't a 'keyword tricks and hacks' role.We're hiring someone who can turn organic search into a predictable revenue engine — a marketer who operates where AI, data, and growth strategy meet.What You'll OwnLead SEO/AEO strategy end-to-endOwn the full search strategy — from technical audits an ...
📑 Role : SDE 2Experience: 2+ YearsLocation: Mumbai- Andheri East (On-site)Introduction-$11 trillion of money flows every year between companies in India. It typically takes avg. 70 days for a business to get paid, and it’s increasing 5% every year, leading to a severe credit crunch in the economy. ...
📑 Job DescriptionWe are looking for a Technical Program Manager with 4–5 years of experience in Project Management, API & Third-Party Integrations, Agile/Scrum, JIRA, Confluence, System Design (HLD), Stakeholder Management, Program Execution, and Risk Management. Candidates with strong technical coordination a ...
📑 Job Title: Java Backend Developer (AWS Cloud) Experience: 5+ Years Location: Hyderabad Work Mode: WFO (5 Days) Job Summary: We are seeking a talented Java Developer with expe ...
📑 What You’ll Be DoingCrafting Experiences: Design and implement intuitive, high-performance user interfaces that make complex developer data easy to navigate.Problem-Solving Wizardry: Break down complex UI/UX challenges into simple, elegant frontend solutions.Code That Speaks: Write high-quality, well ...
📑 Position : Senior Speech Scientist Location : Hyderabad Type : Full-Time CTC : Competitive About YAL YAL.ai (Your Alternative Life) is a revolutionary end-to-end communication and discovery platform reimagining how people connect, interact, and collaborate. We combine state-of-the-art AI with a Zero Trust Archit ...
📑 Job Summary : As an SDE-II, you will design and build high-performance services that power mission-critical ad delivery, targeting, and measurement systems across JioStar's platform. You will operate at the intersection of scale, reliability, and real-time decisioning - supporting live sports, premium entertainm ...
📑 Description :Job Profile: Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based software application. To Analyse domain specific technical or low level requirement and modificatio ...
📑 Description :Job Profile: Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based software application. To Analyse domain specific technical or low level requirement and modificatio ...
📑 Job Description Design, develop, and maintain full-stack web applications using modern frameworks and technologies. Collaborate with cross-functional teams to gather requirements and translate them into technical specifications. Build responsive and accessible ...
📑 Description :Job Profile: Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based software application. To Analyse domain specific technical or low level requirement and modificatio ...
📑 Nitor Infotech Inc. has openings for Technical Architect in Schaumburg, IL: Job Title: Technical Architect Job Duration: 40 Hours / Week, Permanent position, Full time Job Duties: Define and design architecture aligned with business requirements and ...
📑 Design, develop, and maintain full-stack web applications using modern frameworks and technologies. Collaborate with cross-functional teams to gather requirements and translate them into technical specifications. Build responsive and accessible user interfaces using fron ...
📑 Description :Job Profile: Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based software application. To Analyse domain specific technical or low level requirement and modificatio ...
📑 Role: Nodejs_+React Developer Location : BangaloreExperience : 5+ Years Key Responsibilities: Develop and maintain scalable web applications using React.js and <str ...
📑 Description :Job Profile: Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based software application. To Analyse domain specific technical or low level requirement and modificatio ...
📑 Our Company Changing the world through digital experiences is what Adobe’s all about. We give everyone—from emerging artists to global brands—everything they need to design and deliver exceptional digital experiences! We’re passionate about empowering people to create beautiful and powerful i ...
📑 Overview: We are seeking an experienced .NET Full Stack Developer with 4-7 years of professional experience in designing and developing enterprise-grade applications. The ideal candidate should have deep expertise in .NET Core, , and SQL, along with strong exposure to Azure cloud services. This role involves ...
📑 Location: Chennai Experience: 6 - 9 Years The Value You Deliver Developing, designing and building solutions on a digital platform used by the end customer Setting , communicating and reinforcing technical standards Assessing and researching current implementa ...
📑 Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.js, and crafting responsive frontends with Flutter and React.js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store ...
📑 ATS Company: ATS Corporation Requisition ID: 17251 Location: Bangalore, KA, IN #job-location.job-location-inline { display: inline; } Date: Jun 9, 2026 Software Engineer Job Summary The Software Engineer will work closely with other software ...
📑 Develop full‑stack features using Java, Spring Boot, REST APIs, and modern JavaScript frameworks. Build cloud‑native applications and services on AWS (Lambda, S3, SNS/SQS, DynamoDB/RDS, CloudWatch). Implement CI/CD pipelines, automated testing, and deployment workflows. Support production systems, troubleshoo ...
📑 Job Title: Java Backend Developer (AWS Cloud) Experience: 5+ Years Location: Hyderabad Work Mode: WFO (5 Days) Job Summary: We are seeking a talented Java Developer with expertise in building robust, scalable backend systems ...
📑 About QpiAI QPiAI is one of the first quantum computing company from India. At QpiAI, we aim towards designing the full quantum computing stack along with integrating it with special-purpose optimization hardware and GPU accelerators. More information about us can be found ...
📑 Role Summary Builds and maintains robust backend systems with a strong focus on microservices, REST API design, and secure, scalable data processing. Contributes to IoT and time‑series data solutions, Azure‑native development, and performance optimization while actively participating in archit ...
📑 Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.js, and crafting responsive frontends with Flutter and React.js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store and App St ...
📑 Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.js, and crafting responsive frontends with Flutter and React.js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store and App St ...
📑 About QpiAI QPiAI is one of the first quantum computing company from India. At QpiAI, we aim towards designing the full quantum computing stack along with integrating it with special-purpose optimization hardware and GPU accelerators. More information about us can be found at: < ...
📑 About QpiAI QPiAI is one of the first quantum computing company from India. At QpiAI, we aim towards designing the full quantum computing stack along with integrating it with special-purpose optimization hardware and GPU accelerators. More information about us can be found ...
📑 Salesforce Tech Lead Location: @Hyderbad & Chennai Fulltime opportunity Salesforce Tech Lead and Developer with more than ten years of experienc e.Independently build and unit test components and work with development and QA ...
📑 About QpiAI QPiAI is one of the first quantum computing company from India. At QpiAI, we aim towards designing the full quantum computing stack along with integrating it with special-purpose optimization hardware and GPU accelerators. More information about us can be found ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,487,260+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| SDE 2 | Hoomanely | Full-time |
| ShimentoX Technologies - Java +... | Nexthire | Full-time |
| Statusneo - MLOps Engineer | Nexthire | Full-time |
| Electrical CAD Designer: 25-04954 | Akraya | Full-time |
| Software Engineering Senior Advisor | Evernorth | Full-time |
| Back End Developer | People Tech Group Inc | Full-time |
| Lead Application Developer - DevOps | UPS India | Full-time |
| Automotive Linux BSP Senior Engineer | eInfochips Private Limited | Full-time |
| FBS Solution Engineer | Capgemini | Full-time |
| Director - Product Innovation & Engineering | Antal International | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!