📑 Company Provakil is a new-age legal operations management suite for enterprises. Provakil provides an integrated SaaS platform for legal teams to manage all aspects of legal operations including litigation, contracts, compliances, and intellectual property with customize ...
📑 Job DescriptioneAxle Assembly & Product StructureDefine and maintain eAxle assembly structures (system, sub-assemblies, components) aligned with design intent and manufacturing strategy.Support manufacturing-ready assembly concepts, considering tolerance stack-up, serviceability, logistics, and loca ...
📑 Company: Mahindra & Mahindra Ltd Responsibilities & Key Deliverables * Conceptulization of System & sub system of Diesel engine in 3D layout* Review of DFA & DFS requirment* Design calculation for Engine components.* Preparation & review of 2D drawings with DFC & DFM points* Tolerance Sta ...
📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and EV su ...
📑 Job descriptionHiring for: An emerging general insurance business in India. AI-led, fast and transparent.Role: Software Engineer - Backend - Insurance Tech - MumbaiExperience: 5+ YearsLocation(s): Mumbai - Work from office (Vikhroli)Type: On-site / PermanentNotice Period: Immediate to 30 ...
📑 Company: Mahindra & Mahindra Ltd Responsibilities & Key Deliverables Design and develop suspension systems and components: Independent & dependent suspension architectures Leaf spring, coil spring, dampers, linkages, brackets, mounts Sheet metal, Casting & forging part / Components Create ...
📑 Job Title: PCB Design EngineerExperience: 6+ Years (Relevant)About the RoleWe are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard ...
📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standa ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-facing ...
📑 Job Title: PCB Design EngineerExperience: 6+ Years (Relevant)About the RoleWe are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-facing ...
📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and EV su ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...
📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...
📑 Job Title: PCB Design EngineerExperience: 6+ Years (Relevant)About the RoleWe are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...
📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and ...
📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and ...
📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...
📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our con ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...
📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standa ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...
📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...
📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...
📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standa ...
📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...
📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard EDA tools, an ...
📑 Job DescriptioneAxle Assembly & Product StructureDefine and maintain eAxle assembly structures (system, sub-assemblies, components) aligned with design intent and manufacturing strategy.Support manufacturing-ready assembly concepts, considering tolerance stack-up, serviceability, logistics, and ...
📑 JD for Developers: Strong proficiency in React.js, including hooks, state management, component lifecycle, and REST/GraphQL integration Experience building responsive, cross-browser compatible UI with modern JavaScript (ES6+), HTML5, and CSS3 Solid core Java knowledge (OOP, collections ...
📑 Job LocationHYDERABAD OFFICE APAC PSC GDOP Job Description P&G was founded over 180 years ago as a simple soap and candle company. Today, we're the world’s largest consumer goods company and home to iconic, trusted brands that make life a little bit easier in small but meaningful ways. We'v ...
📑 **We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...
📑 DescriptionAs part of the AWS Applied AI Solutions organization, we have a vision to provide business applications, leveraging Amazon’s unique experience and expertise, that are used by millions of companies worldwide to manage day-to-day operations. We will accomplish this by accelerating our customers’ bus ...
📑 Go-to-Market Growth Lead _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Gurgaon, Haryana, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ <br ...
📑 Go-to-Market Growth Lead _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Gurgaon, Haryana, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ <br ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM, Solution ManagerProven leadership of 15–20 team members in shiftsExperience in multiple SAP support projectsSolid understanding of ITIL framework, incident & change management<li ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM, Solution ManagerProven leadership of 15–20 team members in shiftsExperience in multiple SAP support projectsSolid understanding of ITIL framework, incident & change managementAbility to work ind ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...
📑 Designation - Sr. Software Engineer Location: Bangalore Experience: 7-9 years Job Description: • Looking for ServiceNow Developer, having expert level experience in CMDB / ...
📑 The Autonomous Database cloud service framework automates deployment, scaling and management of databases in the cloud and is built on top of Oracle's Cloud Infrastructure (OCI) Layer. The framework features APIs to handle all lifecycle management operations of databases. It also performs operations autonomou ...
📑 Description :Job Details POSITION TITLE : Android HAL (AAOS) Engineer EXPERIENCE : 6 to 9 Years LOCATION : Pune Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based s ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you become better every day. We know what it takes to lead UPS into tomorrow—people with a unique combination of skill + passion. ...
📑 Our Company Changing the world through digital experiences is what Adobe’s all about. We give everyone—from emerging artists to global brands—everything they need to design and deliver exceptional digital experiences! We’re passionate about empowering people to create beautiful and powerful i ...
📑 Overview: We are seeking an experienced .NET Full Stack Developer with 4-7 years of professional experience in designing and developing enterprise-grade applications. The ideal candidate should have deep expertise in .NET Core, , and SQL, along with strong exposure to Azure cloud services. This role involves ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,487,147+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Provakil- Python Developer | Nexthire | Full-time |
| Lead: eAxle Assembly | Bosch Group | Full-time |
| Engineer - Tractor Engines | Mahindra Rise | Full-time |
| Vehicle integration expert- novus | Hero MotoCorp | Full-time |
| Senior back end developer - nodejs - 5+ years | Datavruti | Full-time |
| Senior engineer - Suspension | Mahindra Rise | Full-time |
| PCB Design Engineer | The Briminc Softech | Full-time |
| PCB Design Engineer | The Briminc Softech | Full-time |
| Senior Frontend Developer | Confidential | Full-time |
| PCB Design Engineer | The Briminc Softech | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!