1,487,147+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Provakil Python Developer

📑 Company Provakil is a new-age legal operations management suite for enterprises. Provakil provides an integrated SaaS platform for legal teams to manage all aspects of legal operations including litigation, contracts, compliances, and intellectual property with customize ...

Lead: eAxle Assembly

📑 Job DescriptioneAxle Assembly & Product StructureDefine and maintain eAxle assembly structures (system, sub-assemblies, components) aligned with design intent and manufacturing strategy.Support manufacturing-ready assembly concepts, considering tolerance stack-up, serviceability, logistics, and loca ...

Engineer Tractor Engines

📑 Company: Mahindra & Mahindra Ltd Responsibilities & Key Deliverables * Conceptulization of System & sub system of Diesel engine in 3D layout* Review of DFA & DFS requirment* Design calculation for Engine components.* Preparation & review of 2D drawings with DFC & DFM points* Tolerance Sta ...

Vehicle integration expert novus

📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and EV su ...

Senior back end developer nodejs 5+ years

📑 Job descriptionHiring for: An emerging general insurance business in India. AI-led, fast and transparent.Role: Software Engineer - Backend - Insurance Tech - MumbaiExperience: 5+ YearsLocation(s): Mumbai - Work from office (Vikhroli)Type: On-site / PermanentNotice Period: Immediate to 30 ...

Senior engineer Suspension

📑 Company: Mahindra & Mahindra Ltd Responsibilities & Key Deliverables Design and develop suspension systems and components: Independent & dependent suspension architectures Leaf spring, coil spring, dampers, linkages, brackets, mounts Sheet metal, Casting & forging part / Components Create ...

PCB Design Engineer

📑 Job Title: PCB Design EngineerExperience: 6+ Years (Relevant)About the RoleWe are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard ...

PCB Design Engineer

📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standa ...

Senior Frontend Developer

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-facing ...

PCB Design Engineer

📑 Job Title: PCB Design EngineerExperience: 6+ Years (Relevant)About the RoleWe are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard ...

Senior Frontend Developer

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-facing ...

Vehicle integration expert novus

📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and EV su ...

Senior User Interface Engineer

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...

Senior Frontend Developer

📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...

PCB Design Engineer

📑 Job Title: PCB Design EngineerExperience: 6+ Years (Relevant)About the RoleWe are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard ...

Senior Frontend Developer

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...

Vehicle Integration Expert NOVUS

📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and ...

Vehicle Integration Expert NOVUS

📑 Job Title : Vehicle Integration ExpertFunction : VIDADepartment : Emerging Mobility Business UnitJob Purpose Statement :You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage the interface between complex mechanical and ...

Senior Frontend Developer

📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...

Senior Frontend Developer

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...

Senior Frontend Developer

📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our con ...

Senior Frontend Developer

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...

PCB Design Engineer

📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standa ...

Lead Web Application Developer

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...

Senior Frontend Developer

📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...

Senior Frontend Developer

📑 About the role The scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consumer-faci ...

PCB Design Engineer

📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standa ...

Front End Software Architect

📑 About the roleThe scale at which flipkart operates and grows every year is a challenge for our systems hence UI is no different and we make sure our applications could handle that traffic. As a UI 2 developer at Flipkart, you will be responsible for leading the development of our consu ...

Pcb design engineer

📑 Job Title: PCB Design Engineer Experience: 6+ Years (Relevant) About the Role We are looking for an experienced PCB Design Engineer to join our hardware team. The ideal candidate will have strong hands-on expertise in high-speed multilayer PCB design, industry-standard EDA tools, an ...

Lead: eAxle Assembly

📑 Job DescriptioneAxle Assembly & Product StructureDefine and maintain eAxle assembly structures (system, sub-assemblies, components) aligned with design intent and manufacturing strategy.Support manufacturing-ready assembly concepts, considering tolerance stack-up, serviceability, logistics, and ...

Cyber ET Developer (8441&1181)

📑 JD for Developers: Strong proficiency in React.js, including hooks, state management, component lifecycle, and REST/GraphQL integration   Experience building responsive, cross-browser compatible UI with modern JavaScript (ES6+), HTML5, and CSS3   Solid core Java knowledge (OOP, collections ...

Senior Integration Engineer – Siebel TFM CRM

📑 Job LocationHYDERABAD OFFICE APAC PSC GDOP Job Description P&G was founded over 180 years ago as a simple soap and candle company. Today, we're the world’s largest consumer goods company and home to iconic, trusted brands that make life a little bit easier in small but meaningful ways. We'v ...

Automation Reliability Engineer(4 8 years)

📑 **We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...

Software Development Engineer, JWO

📑 DescriptionAs part of the AWS Applied AI Solutions organization, we have a vision to provide business applications, leveraging Amazon’s unique experience and expertise, that are used by millions of companies worldwide to manage day-to-day operations. We will accomplish this by accelerating our customers’ bus ...

Go to Market Growth Lead

📑 Go-to-Market Growth Lead _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Gurgaon, Haryana, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ <br ...

Go to Market Growth Lead

📑 Go-to-Market Growth Lead _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Gurgaon, Haryana, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ <br ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM, Solution ManagerProven leadership of 15–20 team members in shiftsExperience in multiple SAP support projectsSolid understanding of ITIL framework, incident & change management<li ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM, Solution ManagerProven leadership of 15–20 team members in shiftsExperience in multiple SAP support projectsSolid understanding of ITIL framework, incident & change managementAbility to work ind ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...

SAP Basis Consultant

📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...

YASH TECHNOLOGIES ServiceNow Software Engineer

📑 Designation - Sr. Software Engineer Location: Bangalore Experience: 7-9 years Job Description: • Looking for ServiceNow Developer, having expert level experience in CMDB / ...

Principal Member of Technical Staff Autonomous Database

📑 The Autonomous Database cloud service framework automates deployment, scaling and management of databases in the cloud and is built on top of Oracle's Cloud Infrastructure (OCI) Layer. The framework features APIs to handle all lifecycle management operations of databases. It also performs operations autonomou ...

Automotive Android HAL_Senior Enginer

📑 Description :Job Details POSITION TITLE : Android HAL (AAOS) Engineer EXPERIENCE : 6 to 9 Years LOCATION : Pune Key Responsibilities: Responsible for design and development of real time embedded software/firmware and PC/mobile based s ...

Lead Application Developer DevOps

📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you become better every day. We know what it takes to lead UPS into tomorrow—people with a unique combination of skill + passion. ...

Computer Scientist 2 Java, Kotlin & Android

📑 Our Company Changing the world through digital experiences is what Adobe’s all about. We give everyone—from emerging artists to global brands—everything they need to design and deliver exceptional digital experiences! We’re passionate about empowering people to create beautiful and powerful i ...

Software Engr II

📑 Overview: We are seeking an experienced .NET Full Stack Developer with 4-7 years of professional experience in designing and developing enterprise-grade applications. The ideal candidate should have deep expertise in .NET Core, , and SQL, along with strong exposure to Azure cloud services. This role involves ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,487,147+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Provakil- Python Developer Nexthire Full-time
Lead: eAxle Assembly Bosch Group Full-time
Engineer - Tractor Engines Mahindra Rise Full-time
Vehicle integration expert- novus Hero MotoCorp Full-time
Senior back end developer - nodejs - 5+ years Datavruti Full-time
Senior engineer - Suspension Mahindra Rise Full-time
PCB Design Engineer The Briminc Softech Full-time
PCB Design Engineer The Briminc Softech Full-time
Senior Frontend Developer Confidential Full-time
PCB Design Engineer The Briminc Softech Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!